SitesBLAST
Comparing N515DRAFT_4298 FitnessBrowser__Dyella79:N515DRAFT_4298 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
58% identity, 100% coverage: 2:609/609 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y248), E481 (= E481), K485 (= K485), E488 (= E488), H504 (= H504), K603 (= K604)
- binding glucose-6-phosphate: T302 (= T302), S347 (= S347), Q348 (= Q348), S349 (= S349), T352 (= T352), V399 (= V399), S401 (= S401), E488 (= E488)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
57% identity, 100% coverage: 2:609/609 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y248), E481 (= E481), K485 (= K485), E488 (= E488), H504 (= H504), K603 (= K604)
- binding fructose -6-phosphate: G301 (= G301), T302 (= T302), S303 (= S303), S347 (= S347), Q348 (= Q348), S349 (= S349), T352 (= T352), S401 (= S401), K485 (= K485), E488 (= E488)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
57% identity, 100% coverage: 2:609/609 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99), Y248 (= Y248), E481 (= E481), K485 (= K485), E488 (= E488), H504 (= H504), K603 (= K604)
- binding glucose-6-phosphate: T302 (= T302), S303 (= S303), S347 (= S347), Q348 (= Q348), S349 (= S349), T352 (= T352), S401 (= S401), K485 (= K485), E488 (= E488)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
61% identity, 60% coverage: 244:609/609 of query aligns to 2:366/366 of 1morA
- active site: E239 (= E481), K243 (= K485), E246 (= E488), H262 (= H504), K361 (= K604)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T302), S105 (= S347), Q106 (= Q348), S107 (= S349), T110 (= T352), V157 (= V399), A360 (= A603), K361 (= K604)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
61% identity, 60% coverage: 244:609/609 of query aligns to 2:366/366 of 1moqA
- active site: E239 (= E481), K243 (= K485), E246 (= E488), H262 (= H504), K361 (= K604)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T302), S61 (= S303), S105 (= S347), Q106 (= Q348), S107 (= S349), T110 (= T352), V157 (= V399), A360 (= A603), K361 (= K604)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
61% identity, 60% coverage: 244:609/609 of query aligns to 3:367/367 of 1mosA
- active site: E240 (= E481), K244 (= K485), E247 (= E488), H263 (= H504), K362 (= K604)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T302), S62 (= S303), S106 (= S347), Q107 (= Q348), S108 (= S349), T111 (= T352), K244 (= K485), E247 (= E488)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
39% identity, 100% coverage: 2:609/609 of query aligns to 1:660/660 of 6svmA
- active site: L7 (vs. gap), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E533 (= E481), K537 (= K485), E540 (= E488), H556 (= H504), K655 (= K604)
- binding glucose-6-phosphate: C353 (= C300), T355 (= T302), S356 (= S303), S400 (= S347), Q401 (= Q348), S402 (= S349), T405 (= T352), S453 (= S401), K537 (= K485), E540 (= E488)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), H107 (= H86), G123 (= G99), D147 (= D123)
- binding magnesium ion: S434 (≠ V382), R435 (= R383), T437 (≠ A385)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ E237), R322 (= R270), G334 (= G282), G424 (≠ A372), T426 (≠ C374), S434 (≠ V382), T437 (≠ A385), C439 (≠ L387), G440 (≠ K388), V441 (≠ L389), H442 (≠ M390)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
39% identity, 100% coverage: 2:609/609 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (vs. gap), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E536 (= E481), K540 (= K485), E543 (= E488), H559 (= H504), K658 (= K604)
- binding glucose-6-phosphate: T358 (= T302), S359 (= S303), S403 (= S347), Q404 (= Q348), S405 (= S349), T408 (= T352), S456 (= S401), K540 (= K485), E543 (= E488)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), G123 (= G99), D147 (= D123)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
60% identity, 59% coverage: 244:600/609 of query aligns to 2:357/357 of 7dnrA
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
37% identity, 100% coverage: 1:609/609 of query aligns to 1:699/699 of Q06210
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
38% identity, 99% coverage: 2:602/609 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (vs. gap), R32 (= R27), W95 (= W74), N122 (= N98), G123 (= G99), E532 (= E481), K536 (= K485), E539 (= E488), H555 (= H504)
- binding glucose-6-phosphate: G353 (= G301), T354 (= T302), S355 (= S303), S399 (= S347), Q400 (= Q348), S401 (= S349), T404 (= T352), S452 (= S401), E539 (= E488)
- binding magnesium ion: S433 (≠ V382), R434 (= R383), T436 (≠ A385)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ E237), R321 (= R270), G333 (= G282), G423 (≠ A372), T425 (≠ C374), S433 (≠ V382), T436 (≠ A385), C438 (≠ L387), G439 (≠ K388), V440 (≠ L389), H441 (≠ M390)
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
43% identity, 60% coverage: 245:609/609 of query aligns to 2:365/365 of 2zj4A
- active site: E238 (= E481), K242 (= K485), E245 (= E488), H261 (= H504), K360 (= K604)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T302), S61 (= S303), S105 (= S347), Q106 (= Q348), S107 (= S349), T110 (= T352), V156 (= V399), A157 (= A400), K242 (= K485), E245 (= E488)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
43% identity, 60% coverage: 245:609/609 of query aligns to 2:365/365 of 2zj3A
- active site: E238 (= E481), K242 (= K485), E245 (= E488), H261 (= H504), K360 (= K604)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T302), S61 (= S303), S105 (= S347), Q106 (= Q348), S107 (= S349), T110 (= T352), V156 (= V399), A359 (= A603), K360 (= K604)
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
38% identity, 73% coverage: 167:609/609 of query aligns to 273:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
41% identity, 58% coverage: 245:597/609 of query aligns to 1:352/352 of 2v4mA
- active site: E237 (= E481), K241 (= K485), E244 (= E488), H260 (= H504)
- binding fructose -6-phosphate: T59 (= T302), S60 (= S303), S104 (= S347), Q105 (= Q348), S106 (= S349), T109 (= T352), A156 (= A400), S157 (= S401), K241 (= K485), E244 (= E488)
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
53% identity, 39% coverage: 2:238/609 of query aligns to 1:238/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
53% identity, 39% coverage: 2:238/609 of query aligns to 1:238/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N98), G99 (= G99)
- binding glutamic acid: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N98), G99 (= G99), D123 (= D123)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
40% identity, 57% coverage: 248:597/609 of query aligns to 2:352/352 of 2pocB
- active site: E236 (= E481), K240 (= K485), E243 (= E488), H259 (= H504)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C300), T57 (= T302), S58 (= S303), S102 (= S347), Q103 (= Q348), S104 (= S349), T107 (= T352), E243 (= E488)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R270), G36 (= G282), G126 (≠ A372), V128 (≠ C374), S136 (≠ V382), T139 (≠ A385), C141 (≠ L387), G142 (≠ K388), V143 (≠ L389), H144 (≠ M390)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
38% identity, 57% coverage: 248:597/609 of query aligns to 2:339/339 of 2putA
- active site: E236 (= E481), K240 (= K485), E243 (= E488)
- binding fructose -6-phosphate: C55 (= C300), T57 (= T302), S102 (= S347), Q103 (= Q348), S104 (= S349), T107 (= T352), A154 (= A400), S155 (= S401), K240 (= K485)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R270), G36 (= G282), G126 (≠ A372), V128 (≠ C374), S136 (≠ V382), T139 (≠ A385), C141 (≠ L387), G142 (≠ K388), V143 (≠ L389), H144 (≠ M390)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
38% identity, 58% coverage: 246:597/609 of query aligns to 1:338/338 of 2puvA
- active site: E237 (= E481), K241 (= K485), E244 (= E488)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C300), T58 (= T302), S103 (= S347), Q104 (= Q348), S105 (= S349), T108 (= T352), A155 (= A400), E244 (= E488)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (= R270), G37 (= G282), G127 (≠ A372), V129 (≠ C374), S137 (≠ V382), T140 (≠ A385), C142 (≠ L387), G143 (≠ K388), V144 (≠ L389), H145 (≠ M390)
Query Sequence
>N515DRAFT_4298 FitnessBrowser__Dyella79:N515DRAFT_4298
MCGIVAATAQRDVAPLLIAGLKALEYRGYDSAGLAVLQEGEIRRVREKGKVREMESQYLA
DPFPGGTGIAHTRWATHGVPNKVNAHPHIAGHVALVHNGIIENYASLRSELESRGHAFTS
ETDTEVMAALIGERLASGKSLLDAVSSVVHELEGAYAIAVISDKEPGRVIGARRGAPLLV
GVGIGENFLGSDAQALIQVTNRMIYLEEHDVVEITRDRVRIFGQHGEAVERTIHESELST
DAVERGEYRHYMQKEIFEQPRAVADTLEARIGPHGVLPNIFGVNGDELLGKTKGLHIIAC
GTSYHAGLVAKYWIEDYARLPVNVEVASEYRYREAVVPDGTLFVAISQSGETADTLAAMR
ESRRRGYLGTLAICNVPESSVVREADLKLMTRAGPEIGVASTKAFTTQLAALGLLALQLA
RHRGLDDARYADLTAQLQSLPKKIEKALELEPQIVDLAEHLIHRQHALFLGRGAQYPVAM
EGALKLKEISYIHAEAYAAGELKHGPLALVDEDMPVIAVAPNGPLLDKLKSNLQEVRARG
GELLVFADGAASMDGNAARGSILRIDGGGDFIAPAVFTVPMQLLAYHVAVLRGTDVDQPR
NLAKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory