Comparing N515DRAFT_4302 FitnessBrowser__Dyella79:N515DRAFT_4302 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
70% identity, 98% coverage: 4:291/295 of query aligns to 2:289/293 of 5ifyA
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
70% identity, 97% coverage: 4:290/295 of query aligns to 4:290/295 of 6n0uA
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 12:299/302 of 4b2xB
4asjA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 2:289/292 of 4asjA
1g3lA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tdp-l-rhamnose complex. (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 2:289/292 of 1g3lA
1g2vA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Ttp complex. (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 2:289/292 of 1g2vA
1g1lA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tdp-glucose complex. (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 2:289/292 of 1g1lA
Sites not aligning to the query:
1g0rA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Thymidine/glucose- 1-phosphate complex. (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 2:289/292 of 1g0rA
1fxoA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tmp complex. (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 2:289/292 of 1fxoA
4b5bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 3:290/293 of 4b5bA
4b4gA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 3:290/293 of 4b4gA
4b42A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 3:290/293 of 4b42A
4b3uA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 9:296/299 of 4b3uA
4asyA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 3:290/293 of 4asyA
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
70% identity, 98% coverage: 4:291/295 of query aligns to 8:295/298 of 5fuhA
4b4bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
70% identity, 98% coverage: 4:291/295 of query aligns to 8:295/298 of 4b4bA
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
70% identity, 98% coverage: 4:291/295 of query aligns to 6:293/296 of 5fyeA
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
70% identity, 98% coverage: 4:291/295 of query aligns to 6:293/296 of 5fu0A
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
70% identity, 98% coverage: 4:291/295 of query aligns to 6:293/296 of 5ftvA
5ftsA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
70% identity, 98% coverage: 4:291/295 of query aligns to 6:293/296 of 5ftsA
>N515DRAFT_4302 FitnessBrowser__Dyella79:N515DRAFT_4302
MSTRKGIILAGGSGTRLYPITQAVSKQLLPVYDKPMIYYPLATLMLAGVREILVINTPHE
QPLFERLLGDGSQWGIDIRYAVQPSPDGLAQAFLIGREFIGNDPSCLVLGDNIFYGVGLT
ERLKRASSREHGATVFGYWVRDPERYGVAEFDSSGRVIGLEEKPAQPKSSYAVTGLYFYD
NRVCDYAASLKPSARGELEITDLNRVYLQDNSLHLEQLGRGFAWLDTGTHESLMEAGNYI
ETIENRQGLKVCCPEEIAFINGWIDAEQVLRAAAPLAKTGYGQYLQRLVTQGHIR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory