SitesBLAST
Comparing N515DRAFT_4303 FitnessBrowser__Dyella79:N515DRAFT_4303 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
61% identity, 97% coverage: 11:355/356 of query aligns to 4:352/355 of P27830
- FI 12:13 (= FI 19:20) binding
- DKLT 33:36 (= DKLT 39:42) binding
- DI 59:60 (= DI 65:66) binding
- T100 (= T106) binding
- D135 (= D141) active site, Proton donor
- E136 (= E142) active site, Proton acceptor
- Y160 (= Y165) active site, Proton acceptor
- YSASK 160:164 (= YSASK 165:169) binding
- N190 (= N195) binding
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
58% identity, 96% coverage: 11:350/356 of query aligns to 3:350/361 of 1kewA
- active site: T133 (= T140), D134 (= D141), E135 (= E142), L152 (vs. gap), L154 (vs. gap), F155 (= F153), T158 (≠ Q156), Y167 (= Y165), K171 (= K169)
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), F11 (= F19), I12 (= I20), D32 (= D39), K33 (= K40), L34 (= L41), T35 (= T42), A37 (= A44), G38 (= G45), D58 (= D65), I59 (= I66), L80 (≠ F87), A81 (= A88), A82 (= A89), S84 (= S91), T99 (= T106), I131 (≠ V138), S132 (= S139), T133 (= T140), Y167 (= Y165), K171 (= K169), C194 (= C192), N196 (= N194), N197 (= N195)
- binding thymidine-5'-diphosphate: E135 (= E142), N196 (= N194), K206 (= K204), L207 (= L205), P222 (= P220), Y224 (= Y222), R231 (= R229), N266 (= N264), R297 (= R297), H300 (= H300)
Sites not aligning to the query:
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
58% identity, 96% coverage: 11:350/356 of query aligns to 3:350/361 of 1keuA
- active site: T133 (= T140), D134 (= D141), E135 (= E142), L152 (vs. gap), L154 (vs. gap), F155 (= F153), T158 (≠ Q156), Y167 (= Y165), K171 (= K169)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (= S91), T133 (= T140), D134 (= D141), E135 (= E142), Y167 (= Y165), N196 (= N194), K206 (= K204), L207 (= L205), P222 (= P220), Y224 (= Y222), R231 (= R229), N266 (= N264), R297 (= R297), H300 (= H300)
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), F11 (= F19), I12 (= I20), D32 (= D39), K33 (= K40), L34 (= L41), T35 (= T42), G38 (= G45), D58 (= D65), L80 (≠ F87), A81 (= A88), A82 (= A89), S84 (= S91), T99 (= T106), S132 (= S139), T133 (= T140), Y167 (= Y165), K171 (= K169), C194 (= C192), N196 (= N194), N197 (= N195)
Sites not aligning to the query:
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
58% identity, 96% coverage: 11:350/356 of query aligns to 3:350/361 of P26391
Sites not aligning to the query:
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
59% identity, 96% coverage: 11:353/356 of query aligns to 4:344/344 of 1bxkB
- active site: S125 (≠ Q131), T134 (= T140), D135 (= D141), E136 (= E142), S158 (= S163), Y160 (= Y165), S161 (= S166), K164 (= K169)
- binding nicotinamide-adenine-dinucleotide: G8 (= G15), G11 (= G18), F12 (= F19), I13 (= I20), D33 (= D39), K34 (= K40), L35 (= L41), T36 (= T42), A38 (= A44), G39 (= G45), D59 (= D65), I60 (= I66), L81 (≠ F87), A83 (= A89), T100 (= T106), I132 (≠ V138), S133 (= S139), T134 (= T140), K164 (= K169), C187 (= C192)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
52% identity, 96% coverage: 11:350/356 of query aligns to 6:353/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G15), G13 (= G18), F14 (= F19), I15 (= I20), D36 (= D39), A37 (≠ K40), L38 (= L41), T39 (= T42), G42 (= G45), D62 (= D65), I63 (= I66), L84 (≠ F87), A85 (= A88), A86 (= A89), T103 (= T106), S143 (= S139), T144 (= T140), Y169 (= Y165), K173 (= K169), C196 (= C192)
6bi4C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
51% identity, 93% coverage: 11:340/356 of query aligns to 4:306/311 of 6bi4C
- active site: T117 (= T140), D118 (= D141), E119 (= E142), Y142 (= Y165), K146 (= K169)
- binding beta-D-fructofuranose: Q62 (≠ G67), N63 (≠ D68), G64 (≠ R69), E65 (= E70)
- binding nicotinamide-adenine-dinucleotide: G8 (= G15), G11 (= G18), F12 (= F19), I13 (= I20), D34 (= D39), A35 (≠ K40), L36 (= L41), T37 (= T42), S39 (≠ A44), G40 (= G45), E60 (≠ D65), I61 (= I66), Q62 (≠ G67), F82 (= F87), A83 (= A88), A84 (= A89), T92 (= T106), V115 (= V138), T117 (= T140), Y142 (= Y165), K146 (= K169), C169 (= C192), S170 (= S193)
6bi4B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
50% identity, 93% coverage: 11:340/356 of query aligns to 4:305/310 of 6bi4B
- active site: T117 (= T140), D118 (= D141), E119 (= E142), Y142 (= Y165), K146 (= K169)
- binding alpha-D-glucopyranose: Q62 (≠ G67), N63 (≠ D68)
- binding nicotinamide-adenine-dinucleotide: G8 (= G15), G11 (= G18), F12 (= F19), I13 (= I20), D34 (= D39), A35 (≠ K40), L36 (= L41), T37 (= T42), S39 (≠ A44), G40 (= G45), E60 (≠ D65), F82 (= F87), A83 (= A88), A84 (= A89), T92 (= T106), S116 (= S139), T117 (= T140), Y142 (= Y165), K146 (= K169), C169 (= C192)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
47% identity, 95% coverage: 8:346/356 of query aligns to 1:318/329 of 2hunA
- active site: T125 (= T140), D126 (= D141), E127 (= E142), Y149 (= Y165), K153 (= K169)
- binding nicotinamide-adenine-dinucleotide: G8 (= G15), G11 (= G18), F12 (= F19), I13 (= I20), D34 (= D39), K35 (= K40), S40 (≠ G45), D60 (= D65), V61 (≠ I66), L80 (≠ F87), A81 (= A88), A82 (= A89), S99 (≠ T106), T125 (= T140), K153 (= K169), C176 (= C192), T177 (≠ S193), N178 (= N194), N179 (= N195)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
50% identity, 93% coverage: 11:342/356 of query aligns to 3:319/322 of 1r66A
- active site: T127 (= T140), D128 (= D141), E129 (= E142), Y151 (= Y165), K155 (= K169)
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), F11 (= F19), I12 (= I20), D37 (= D39), S38 (≠ K40), L39 (= L41), T40 (= T42), G43 (= G45), D63 (= D65), I64 (= I66), F83 (= F87), A84 (= A88), A85 (= A89), S87 (= S91), T102 (= T106), V125 (= V138), S126 (= S139), Y151 (= Y165), K155 (= K169), N181 (= N195)
- binding thymidine-5'-diphosphate: H88 (= H92), E129 (= E142), N180 (= N194), K190 (= K204), L191 (= L205), P206 (= P220), Y208 (= Y222), R215 (= R229), N250 (≠ V267), R274 (= R297), H277 (= H300)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
50% identity, 93% coverage: 11:342/356 of query aligns to 3:319/322 of 1r6dA
- active site: T127 (= T140), N128 (≠ D141), Q129 (≠ E142), Y151 (= Y165), K155 (= K169)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S91), H88 (= H92), T127 (= T140), N128 (≠ D141), Q129 (≠ E142), Y151 (= Y165), N180 (= N194), K190 (= K204), L191 (= L205), P206 (= P220), Y208 (= Y222), R215 (= R229), N250 (≠ V267), R274 (= R297), H277 (= H300), Y281 (= Y304)
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), F11 (= F19), I12 (= I20), D37 (= D39), S38 (≠ K40), L39 (= L41), T40 (= T42), A42 (= A44), G43 (= G45), D63 (= D65), I64 (= I66), F83 (= F87), A84 (= A88), A85 (= A89), S87 (= S91), T102 (= T106), V125 (= V138), S126 (= S139), Y151 (= Y165), K155 (= K169), N181 (= N195)
1ketA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound (see paper)
46% identity, 93% coverage: 11:340/356 of query aligns to 5:326/346 of 1ketA
- active site: T123 (= T140), D124 (= D141), E125 (= E142), Y159 (= Y165), K163 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), F13 (= F19), I14 (= I20), D35 (= D39), K36 (= K40), L37 (= L41), T38 (= T42), A40 (= A44), G41 (= G45), D60 (= D65), I61 (= I66), Y80 (≠ F87), A82 (= A89), S84 (= S91), T99 (= T106), S122 (= S139), T123 (= T140), Y159 (= Y165), K163 (= K169)
- binding thymidine-5'-diphosphate: E125 (= E142), N188 (= N194), F199 (≠ L205), R202 (≠ L208), Q203 (≠ V209), K214 (≠ P220), Y216 (= Y222), R223 (= R229), N258 (= N264), R282 (= R297), H285 (= H300)
1kepA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound (see paper)
46% identity, 93% coverage: 11:340/356 of query aligns to 5:326/346 of 1kepA
- active site: T123 (= T140), D124 (= D141), E125 (= E142), Y159 (= Y165), K163 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), F13 (= F19), I14 (= I20), D35 (= D39), K36 (= K40), L37 (= L41), T38 (= T42), G41 (= G45), D60 (= D65), I61 (= I66), Y80 (≠ F87), A81 (= A88), A82 (= A89), S84 (= S91), T99 (= T106), S122 (= S139), Y159 (= Y165), K163 (= K169), N189 (= N195)
- binding thymidine-5'-diphospho-beta-d-xylose: S84 (= S91), T123 (= T140), E125 (= E142), Y159 (= Y165), N188 (= N194), K198 (= K204), R223 (= R229), R282 (= R297)
1kerB The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound (see paper)
46% identity, 93% coverage: 11:340/356 of query aligns to 6:327/347 of 1kerB
- active site: T124 (= T140), D125 (= D141), E126 (= E142), Y160 (= Y165), K164 (= K169)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S85 (= S91), N87 (≠ V93), T124 (= T140), D125 (= D141), E126 (= E142), Y160 (= Y165), N189 (= N194), K199 (= K204), F200 (≠ L205), R203 (≠ L208), Q204 (≠ V209), K215 (≠ P220), L216 (≠ V221), Y217 (= Y222), R224 (= R229), N259 (= N264), R283 (= R297), H286 (= H300)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), F14 (= F19), I15 (= I20), D36 (= D39), K37 (= K40), L38 (= L41), T39 (= T42), G42 (= G45), D61 (= D65), I62 (= I66), Y81 (≠ F87), A82 (= A88), A83 (= A89), S85 (= S91), T100 (= T106), S123 (= S139), T124 (= T140), Y160 (= Y165), K164 (= K169), C187 (= C192), N190 (= N195)
8sk0B Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
46% identity, 94% coverage: 7:342/356 of query aligns to 5:323/330 of 8sk0B
- binding nicotinamide-adenine-dinucleotide: G17 (= G18), F18 (= F19), I19 (= I20), D44 (= D39), S45 (≠ K40), L46 (= L41), T47 (= T42), G50 (= G45), D68 (= D65), I69 (= I66), F88 (= F87), A89 (= A88), A90 (= A89), T92 (≠ S91), T107 (= T106), V130 (= V138), Y156 (= Y165), K160 (= K169), G184 (≠ S193), N186 (= N195)
8sk0A Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
46% identity, 94% coverage: 7:342/356 of query aligns to 4:322/329 of 8sk0A
- binding nicotinamide-adenine-dinucleotide: G16 (= G18), F17 (= F19), I18 (= I20), D43 (= D39), S44 (≠ K40), L45 (= L41), T46 (= T42), G49 (= G45), D67 (= D65), F87 (= F87), A88 (= A88), A89 (= A89), T91 (≠ S91), T106 (= T106), V129 (= V138), S130 (= S139), T131 (= T140), Y155 (= Y165), K159 (= K169)
- binding thymidine-5'-diphosphate: E133 (= E142), N184 (= N194), K194 (= K204), V195 (≠ L205), P210 (= P220), Y212 (= Y222), R219 (= R229), N254 (= N264), R278 (= R297), H281 (= H300)
P95780 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
44% identity, 93% coverage: 11:340/356 of query aligns to 7:328/348 of P95780
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
41% identity, 93% coverage: 11:340/356 of query aligns to 11:327/667 of Q9LPG6
- G18 (= G18) mutation to A: Abolishes dehydratase activity.
- K36 (= K34) mutation to A: Reduces dehydratase activity.
- D96 (= D94) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K169) mutation to A: Abolishes dehydratase activity.
- G193 (= G197) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
41% identity, 96% coverage: 1:340/356 of query aligns to 1:325/669 of Q9SYM5
- R283 (= R297) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
36% identity, 92% coverage: 11:338/356 of query aligns to 6:316/319 of 6vloA
- active site: T126 (= T140), D127 (= D141), E128 (= E142), Y151 (= Y165), K155 (= K169)
- binding nicotinamide-adenine-dinucleotide: G10 (= G15), G13 (= G18), F14 (= F19), I15 (= I20), D36 (≠ T42), I37 (≠ Y43), A42 (≠ D48), D59 (= D65), I60 (= I66), F81 (= F87), A82 (= A88), A83 (= A89), S85 (= S91), M124 (≠ V138), T126 (= T140), K155 (= K169)
- binding thymidine-5'-diphosphate: N180 (= N194), K190 (= K204), L191 (= L205), K194 (≠ L208), H206 (≠ P220), Q208 (≠ Y222), R215 (= R229), V250 (≠ N264), R275 (= R297), R281 (= R303)
Query Sequence
>N515DRAFT_4303 FitnessBrowser__Dyella79:N515DRAFT_4303
MSSPLPGSSPLLVTGGAGFIGANFVLRAIAEGRKVVNLDKLTYAGNLDTLASLQDNPLHV
FVQGDIGDRELIARLLATHRPSAIVNFAAESHVDRSIDGPAAFVETNVVGTLALLEAARD
YWKSLEGGAAQSFRFLHVSTDEVYGSLGSEGKFTEQTPYAPNSPYSASKAASDHLVRAFH
HTYGLPVLTTNCSNNYGPYQFPEKLIPLVIQKALAGEPLPVYGDGMNIRDWLFVGDHCSA
IARVLEAGQVGETYNVGGNAERENLTVVKAICALLDERHPLADGRRREALITFVKDRPGH
DRRYAIDASKLQRELGWTPSQTFESGIAQTVHWYLDNQAWVERVLDGSYRMERLGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory