Comparing N515DRAFT_4331 FitnessBrowser__Dyella79:N515DRAFT_4331 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
58% identity, 98% coverage: 3:361/366 of query aligns to 2:360/363 of 3a8iA
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
42% identity, 97% coverage: 3:358/366 of query aligns to 2:357/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
42% identity, 97% coverage: 3:358/366 of query aligns to 2:357/362 of 1wopA
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
42% identity, 97% coverage: 3:358/366 of query aligns to 2:357/362 of 1wooA
Sites not aligning to the query:
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
36% identity, 97% coverage: 4:357/366 of query aligns to 35:395/403 of P48728
Sites not aligning to the query:
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
36% identity, 97% coverage: 4:357/366 of query aligns to 4:364/371 of 1wsvA
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
31% identity, 88% coverage: 36:357/366 of query aligns to 521:848/866 of Q9UI17
Sites not aligning to the query:
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
30% identity, 88% coverage: 36:357/366 of query aligns to 514:841/857 of Q63342
Sites not aligning to the query:
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
30% identity, 88% coverage: 36:357/366 of query aligns to 477:804/824 of 4pabB
Sites not aligning to the query:
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
29% identity, 90% coverage: 5:333/366 of query aligns to 577:929/965 of 2gagA
Sites not aligning to the query:
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
30% identity, 73% coverage: 5:272/366 of query aligns to 576:856/963 of 3ad7A
Sites not aligning to the query:
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
30% identity, 73% coverage: 5:272/366 of query aligns to 576:856/963 of 1vrqA
Sites not aligning to the query:
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
30% identity, 73% coverage: 5:272/366 of query aligns to 577:857/965 of Q50LF0
Sites not aligning to the query:
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
28% identity, 95% coverage: 5:351/366 of query aligns to 579:952/967 of Q46337
Sites not aligning to the query:
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
29% identity, 88% coverage: 35:356/366 of query aligns to 489:814/824 of Q8GAI3
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
26% identity, 96% coverage: 7:356/366 of query aligns to 435:820/830 of Q9AGP8
Sites not aligning to the query:
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
26% identity, 96% coverage: 7:356/366 of query aligns to 433:818/828 of 1pj6A
Sites not aligning to the query:
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
26% identity, 96% coverage: 7:356/366 of query aligns to 432:817/827 of 1pj7A
Sites not aligning to the query:
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
26% identity, 96% coverage: 7:356/366 of query aligns to 432:817/827 of 3gsiA
Sites not aligning to the query:
3tfjA Dmsp-dependent demethylase from p. Ubique - with cofactor thf (see paper)
24% identity, 91% coverage: 26:357/366 of query aligns to 37:369/369 of 3tfjA
Sites not aligning to the query:
>N515DRAFT_4331 FitnessBrowser__Dyella79:N515DRAFT_4331
MTEKTVLNATHRALGARMVDFGGWDMPINYGSQIEEHHAVRQDAGMFDVSHMTVVDLHGE
RTREFLRHLLANNVDKLKAQGKALYSCMLDEQGGVIDDLIVYFFDDRHFRLVVNAATRAK
DLAWIEQQAKAFGVEVKERPDFSMIAVQGPNARDKVIGLLHEVDRERIRKLGKFVAAAAQ
GPHGMPLFIARTGYTGEDGFEIIVPEEHAVALWEALLAAGVKPAGLGARDTLRLEAGMNL
YGQDMDETVSPWEANLGWTISLDEGRDFIGRKVLEAQKAAGVKRVMVGLVLDEKGVLRHG
QKVLTANGEGEILSGSFAPTLNKAVAFARIPAGEPGEVRVDIRGREVPVRVVKYPFVRDG
KPCEGI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory