Comparing N515DRAFT_4362 FitnessBrowser__Dyella79:N515DRAFT_4362 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
34% identity, 82% coverage: 62:339/339 of query aligns to 47:371/374 of D2Z028
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
33% identity, 76% coverage: 83:338/339 of query aligns to 54:342/346 of 5w8oB
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
31% identity, 77% coverage: 79:339/339 of query aligns to 58:356/358 of P45131
Sites not aligning to the query:
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
33% identity, 76% coverage: 82:339/339 of query aligns to 69:362/367 of 8f2lA
Sites not aligning to the query:
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
33% identity, 76% coverage: 82:339/339 of query aligns to 69:362/368 of 7rytB
Sites not aligning to the query:
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
33% identity, 76% coverage: 82:339/339 of query aligns to 70:363/366 of 6puxA
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
30% identity, 83% coverage: 56:338/339 of query aligns to 41:362/366 of 6ioiA
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
30% identity, 83% coverage: 56:338/339 of query aligns to 41:362/375 of 6iohA
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 63% coverage: 62:274/339 of query aligns to 119:359/504 of Q10341
Sites not aligning to the query:
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
24% identity, 73% coverage: 78:324/339 of query aligns to 69:358/387 of Q6FEQ3
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
26% identity, 75% coverage: 85:338/339 of query aligns to 63:347/350 of 2vavB
Sites not aligning to the query:
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
25% identity, 75% coverage: 85:338/339 of query aligns to 62:345/347 of 2vatA
>N515DRAFT_4362 FitnessBrowser__Dyella79:N515DRAFT_4362
MSSQPQPVTSASAPCTVAGAVRVDLTTQRSSRRIRLSPKYGSRPCEVDVRYLWCGAPDAP
TVIVQGGISANREVVALDDEATPGWWQEAVGAGRPIDLDRYRVLCIDWLTPAELDGATAV
SSEDQADALAALVEALGIARVHAFIGSSYGAMAGLAFAARHPYALDRLVLLAGAHRPHPL
ATAQRAVQRGIVRLGVETGQPEQALSLARQLAMTTYRGSEEFSRRFTAAPEFREGRFHFP
VEDYLVHQGRRFVERFDVERFLALSESIDLHDVTPERIAAPATLIGFPSDRLVPLSDLCE
LQRRLHGPATLEVLESPYGHDAFLKETHRLAPLLRDALA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory