Comparing NP_346859.1 NCBI__GCF_000008765.1:NP_346859.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3mwbA The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
29% identity, 97% coverage: 7:274/275 of query aligns to 6:276/306 of 3mwbA
3mwbB The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
29% identity, 97% coverage: 7:274/275 of query aligns to 6:273/303 of 3mwbB
P0A9J8 Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 from Escherichia coli (strain K12)
25% identity, 88% coverage: 3:245/275 of query aligns to 105:348/386 of P0A9J8
Sites not aligning to the query:
2qmxA The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls (see paper)
26% identity, 97% coverage: 5:272/275 of query aligns to 5:273/278 of 2qmxA
6vh5D Crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine
26% identity, 89% coverage: 28:272/275 of query aligns to 29:276/282 of 6vh5D
3luyA Putative chorismate mutase from bifidobacterium adolescentis
22% identity, 99% coverage: 2:274/275 of query aligns to 4:285/326 of 3luyA
7am0B Gqqa- a novel type of quorum quenching acylases (see paper)
20% identity, 88% coverage: 5:245/275 of query aligns to 5:242/278 of 7am0B
>NP_346859.1 NCBI__GCF_000008765.1:NP_346859.1
MKKAAVLGPKGTFSEFAVKEYKNKIDNNIEMIFCSTISKVVKAAEEECDIAIIPIENTLD
GFVQVTLDLLSKTNLNIIYELVLPIQFAFAANSKMEEVQRVYAQFKTQGQCCEFLEKHDE
FKIITTESNGQSLKKLKEGVLGEGAIVPAYAVKGTNKFKCNINNVTDSEGNETRFIVLSK
EKVQYEGKGYYKTGIIISDANADKPGTLWRVLNEFSVRDINLTSIISRPTKKGLGQYYFF
IEVDGCYFKDNRLNEAVEAIKHHSVVKVVGTYYKI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory