Comparing NP_660983.1 NCBI__GCF_000006985.1:NP_660983.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3triA Structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii (see paper)
40% identity, 98% coverage: 5:266/266 of query aligns to 4:269/272 of 3triA
5bshA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with l-proline (see paper)
38% identity, 98% coverage: 5:264/266 of query aligns to 10:271/272 of 5bshA
5bsgA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with NADP+ (see paper)
38% identity, 98% coverage: 5:264/266 of query aligns to 10:271/272 of 5bsgA
5bsfA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with NAD+ (see paper)
38% identity, 98% coverage: 5:264/266 of query aligns to 10:271/272 of 5bsfA
5bseA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) (see paper)
38% identity, 98% coverage: 5:264/266 of query aligns to 10:271/272 of 5bseA
Q96C36 Pyrroline-5-carboxylate reductase 2; P5C reductase 2; P5CR 2; EC 1.5.1.2 from Homo sapiens (Human) (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 1:268/320 of Q96C36
6xp0A Structure of human pycr1 complexed with n-formyl l-proline (see paper)
36% identity, 98% coverage: 4:264/266 of query aligns to 3:267/272 of 6xp0A
2rcyA Crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with NADP bound
34% identity, 99% coverage: 1:264/266 of query aligns to 2:260/262 of 2rcyA
8td1A Structure of pycr1 complexed with 3-(6-oxa-9-azaspiro(4.5)decane-9- carbonyl)benzoic acid (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 8:275/280 of 8td1A
8td0A Structure of pycr1 complexed with 5-oxo-7a-phenyl-hexahydropyrrolo[2, 1-b][1,3]thiazole-3-carboxylic acid (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 8:275/280 of 8td0A
8tczA Structure of pycr1 complexed with 2-(pyridin-2-yl)cyclopropane-1- carboxylic acid (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 8:275/280 of 8tczA
8tcxA Structure of pycr1 complexed with 2,4-dioxo-1,2,3,4- tetrahydroquinazoline-6-carboxylic acid (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 8:275/280 of 8tcxA
5uavA Structure of human pycr-1 complexed with NADPH and l-tetrahydrofuroic acid (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 5:272/278 of 5uavA
5uatC Structure of human pycr-1 complexed with NADPH (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 5:272/277 of 5uatC
8tcyA Structure of pycr1 complexed with 7-fluoro-2-oxo-1,2,3,4- tetrahydroquinoline-6-carboxylic acid (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 8:275/281 of 8tcyA
8tcwA Structure of pycr1 complexed with 2-methyl-3-(2-oxoimidazolidin-1-yl) benzoic acid (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 8:275/282 of 8tcwA
8tcvB Structure of pycr1 complexed with 4-bromobenzene-1,3-dicarboxylic acid (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 7:274/279 of 8tcvB
2izzA Crystal structure of human pyrroline-5-carboxylate reductase
35% identity, 98% coverage: 4:264/266 of query aligns to 2:269/272 of 2izzA
8tcuA Structure of pycr1 complexed with 2-chloro-5-(2-oxoimidazolidin-1-yl) benzoic acid (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 8:275/279 of 8tcuA
6xp3A Structure of human pycr1 complexed with cyclopentanecarboxylic acid (see paper)
35% identity, 98% coverage: 4:264/266 of query aligns to 4:271/276 of 6xp3A
>NP_660983.1 NCBI__GCF_000006985.1:NP_660983.1
MARLSIGFIGTGRIAQALISGLSHDPNIVICGYDKMPDALHSVSLQYGVNTEESIESLAR
DAEIIVIAVKPYQMAEVLAELKPALHGQHLIVSVAAGISTGFIESNCPEGTRVVRVMPNT
PAFVGEGMTALCKGMHATADDLLVAERIFNAIGKTAIIEESGMDAATAVSGSGPAYMFRI
IDSLAEGGEACGLDRETAQLLAAQTMLGAAKMVLSGHKSPEELVREVTTPGGTTEAGLKA
MDERDLRGALIDTVRAAAARSKELMK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory