SitesBLAST
Comparing NP_662005.1 NCBI__GCF_000006985.1:NP_662005.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P59846 Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 2 papers)
49% identity, 97% coverage: 5:393/401 of query aligns to 2:389/400 of P59846
- 6:14 (vs. 9:17, 100% identical) binding
- A33 (≠ G37) binding
- G114 (= G118) binding
7k5zA Crystal structure of argininosuccinate synthase from legionella pneumophila philadelphia 1 in complex with anppnp and a substrate analogue arginine
48% identity, 99% coverage: 4:399/401 of query aligns to 4:385/390 of 7k5zA
- active site: D15 (= D15), R95 (= R96), D124 (= D125), S176 (= S177)
- binding phosphoaminophosphonic acid-adenylate ester: A9 (= A9), Y10 (= Y10), S11 (= S11), C37 (≠ G37), G117 (= G118), F128 (= F129)
- binding arginine: Y88 (= Y88), T92 (= T92), D124 (= D125), R127 (= R128), S185 (= S186), E187 (= E188), E261 (= E262), Y273 (= Y274)
4xfjB Crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine
50% identity, 96% coverage: 4:389/401 of query aligns to 2:386/397 of 4xfjB
- active site: D13 (= D15), R94 (= R96), D123 (= D125), S174 (= S177)
- binding phosphoaminophosphonic acid-adenylate ester: A7 (= A9), Y8 (= Y10), S9 (= S11), T14 (= T16), I34 (≠ G37), G116 (= G118), C117 (= C119), F127 (= F129)
- binding arginine: Y86 (= Y88), S90 (≠ T92), R126 (= R128), A183 (≠ S186), E185 (= E188), E259 (= E262), E269 (= E272), Y271 (= Y274)
1j20A Crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with product (see paper)
48% identity, 97% coverage: 5:393/401 of query aligns to 2:380/386 of 1j20A
- active site: D12 (= D15), R92 (= R96), D121 (= D125), S168 (= S177)
- binding adenosine monophosphate: A6 (= A9), T13 (= T16), A33 (≠ G37), R92 (= R96), H113 (= H117), G114 (= G118), F125 (= F129)
- binding argininosuccinate: Y84 (= Y88), T88 (= T92), A115 (≠ C119), T116 (= T120), G119 (= G123), N120 (= N124), D121 (= D125), R124 (= R128), S177 (= S186), E179 (= E188), E253 (= E262), Y265 (= Y274)
1j1zA Crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with substrate (see paper)
48% identity, 97% coverage: 5:393/401 of query aligns to 2:380/386 of 1j1zA
- active site: D12 (= D15), R92 (= R96), D121 (= D125), S168 (= S177)
- binding aspartic acid: A115 (≠ C119), T116 (= T120), G119 (= G123), N120 (= N124), D121 (= D125)
- binding adenosine-5'-triphosphate: A6 (= A9), T13 (= T16), A33 (≠ G37), R92 (= R96), I95 (≠ L99), H113 (= H117), G114 (= G118), F125 (= F129)
- binding citrulline: Y84 (= Y88), T88 (= T92), R124 (= R128), S168 (= S177), M169 (≠ I178), S177 (= S186), E179 (= E188), E253 (= E262), Y265 (= Y274)
1kh3A Crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with inhibitor (see paper)
48% identity, 97% coverage: 5:393/401 of query aligns to 2:374/380 of 1kh3A
- active site: D12 (= D15), R92 (= R96), D121 (= D125), S168 (= S177)
- binding phosphoaminophosphonic acid-adenylate ester: A6 (= A9), T13 (= T16), T32 (= T36), A33 (≠ G37), H113 (= H117), G114 (= G118), F125 (= F129), S168 (= S177), M169 (≠ I178)
- binding arginine: Y84 (= Y88), T88 (= T92), R124 (= R128), S168 (= S177), M169 (≠ I178), D170 (= D179), S177 (= S186), E179 (= E188), E253 (= E262), Y265 (= Y274)
- binding aspartic acid: A115 (≠ C119), T116 (= T120), G119 (= G123), N120 (= N124), D121 (= D125)
P00966 Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 from Homo sapiens (Human) (see 16 papers)
43% identity, 99% coverage: 2:398/401 of query aligns to 3:406/412 of P00966
- V64 (≠ L65) to I: in CTLN1; uncertain significance; dbSNP:rs556297791
- Y87 (= Y88) binding
- T91 (= T92) to P: in CTLN1; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs769018733
- S92 (≠ A93) binding
- R95 (= R96) to S: in CTLN1; increased thermal stability; loss of argininosuccinate synthase activity
- P96 (= P97) to H: in CTLN1; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; to L: in CTLN1; decreased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; loss of argininosuccinate synthase activity; to S: in CTLN1; no effect on thermal stability; decreased argininosuccinate synthase activity
- G117 (= G118) to S: in CTLN1; decreased thermal stability; loss of argininosuccinate synthase activity; dbSNP:rs770944877
- A118 (≠ C119) to T: in CTLN1; decreased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs775305020
- T119 (= T120) binding ; to I: in CTLN1; decreased thermal stability; loss of argininosuccinate synthase activity
- N123 (= N124) binding ; binding
- D124 (= D125) binding ; to N: in CTLN1; loss of argininosuccinate synthase activity; dbSNP:rs936192871
- R127 (= R128) binding ; to L: increased thermal stability; loss of argininosuccinate synthase activity; dbSNP:rs201623252; to Q: in CTLN1; increased thermal stability; loss of argininosuccinate synthase activity; dbSNP:rs201623252; to W: in CTLN1; severe clinical course; loss of argininosuccinate synthase activity; dbSNP:rs771794639
- R157 (vs. gap) to C: in CTLN1; decreased thermal stability; loss of argininosuccinate synthase activity; dbSNP:rs770585183; to H: in CTLN1; loss of argininosuccinate synthase activity; dbSNP:rs121908637
- K165 (≠ M162) modified: N6-acetyllysine; by CLOCK; mutation K->Q,R: Significant loss of acetylation but no decrease in enzyme activity; when associated with Q-176 or R-176.
- K176 (= K173) modified: N6-acetyllysine; by CLOCK; mutation K->Q,R: Significant loss of acetylation but no decrease in enzyme activity; when associated with Q-165 or R-165.
- W179 (≠ Y176) to R: in CTLN1; mild; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs121908646
- S180 (= S177) binding ; to I: in CTLN1; increased thermal stability; loss of argininosuccinate synthase activity; dbSNP:rs121908638; to N: in CTLN1; decreased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs121908638
- S189 (= S186) binding
- E191 (= E188) to Q: in CTLN1; loss of argininosuccinate synthase activity
- A192 (≠ C189) to V: in CTLN1; decreased protein abundance
- V263 (= V255) to M: in CTLN1; mild clinical course; no effect on affinity for aspartate; no effect on affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs192838388
- R265 (= R257) to C: in CTLN1; severe clinical course; loss of argininosuccinate synthase activity; dbSNP:rs148918985
- E270 (= E262) binding ; to Q: in CTLN1; loss of argininosuccinate synthase activity; dbSNP:rs775163147
- R272 (= R264) to C: in CTLN1; increased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs762387914; to H: in CTLN1; increased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs768215008; to L: in CTLN1; increased thermal stability; decreased affinity for aspartate; decreased affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs768215008
- G280 (≠ E272) to R: in CTLN1; loss of argininosuccinate synthase activity
- Y282 (= Y274) binding
- T284 (≠ A276) to I: in CTLN1; mild clinical course; dbSNP:rs886039853
- M302 (≠ L294) to V: in CTLN1; no effect on affinity for aspartate; no effect on affinity for citrulline; decreased argininosuccinate synthase activity
- R304 (≠ K296) to W: in CTLN1; decreased protein abundance; dbSNP:rs121908642
- G324 (= G316) to S: in CTLN1; loss of argininosuccinate synthase activity; dbSNP:rs121908639
- G347 (= G339) to R: in CTLN1; severe clinical course
- Y359 (≠ T351) to D: in CTLN1; mild clinical course
- G362 (= G354) to V: in CTLN1; mild; no effect on affinity for aspartate; no effect on affinity for citrulline; decreased argininosuccinate synthase activity; dbSNP:rs121908647
- G390 (= G382) to R: in CTLN1; loss of argininosuccinate synthase activity; dbSNP:rs121908641
2nz2A Crystal structure of human argininosuccinate synthase in complex with aspartate and citrulline (see paper)
43% identity, 99% coverage: 3:398/401 of query aligns to 1:401/402 of 2nz2A
- active site: D13 (= D15), R92 (= R96), D121 (= D125), S176 (= S177)
- binding aspartic acid: A115 (≠ C119), T116 (= T120), G119 (= G123), N120 (= N124), D121 (= D125)
- binding citrulline: Y84 (= Y88), T88 (= T92), N120 (= N124), R124 (= R128), D178 (= D179), S185 (= S186), E187 (= E188), E266 (= E262), Y278 (= Y274)
5us8A 2.15 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis
32% identity, 90% coverage: 2:362/401 of query aligns to 13:385/445 of 5us8A
6e5yA 1.50 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis in complex with amp.
32% identity, 90% coverage: 2:362/401 of query aligns to 9:381/438 of 6e5yA
P0A6E4 Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 from Escherichia coli (strain K12) (see 4 papers)
30% identity, 93% coverage: 4:374/401 of query aligns to 12:394/447 of P0A6E4
- 17:25 (vs. 9:17, 89% identical) binding
- A43 (≠ G37) binding
- Y99 (= Y88) binding
- G129 (= G118) binding
- T131 (= T120) binding ; binding
- N135 (= N124) binding ; binding
- D136 (= D125) binding ; binding
- R139 (= R128) binding
- S192 (= S177) binding
- D194 (= D179) binding
- T201 (≠ S186) binding
- E203 (= E188) binding
- E280 (= E262) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kp3A Crystal structure of e. Coli argininosuccinate synthetase in complex with atp and citrulline (see paper)
30% identity, 92% coverage: 4:373/401 of query aligns to 11:392/439 of 1kp3A
- active site: D22 (= D15), R106 (= R96), D135 (= D125), S191 (= S177)
- binding adenosine-5'-triphosphate: A16 (= A9), S18 (= S11), G20 (= G13), D22 (= D15), T23 (= T16), T41 (= T36), A42 (≠ G37), D127 (≠ H117), G128 (= G118), S129 (≠ C119), F139 (= F129), D193 (= D179)
- binding citrulline: Y98 (= Y88), T102 (= T92), P103 (≠ A93), T130 (= T120), G133 (= G123), N134 (= N124), D135 (= D125), R138 (= R128), D193 (= D179), T200 (≠ S186), E202 (= E188), E202 (= E188), E279 (= E262), S287 (= S270), Y291 (= Y274)
1k97A Crystal structure of e. Coli argininosuccinate synthetase in complex with aspartate and citrulline (see paper)
30% identity, 90% coverage: 4:362/401 of query aligns to 11:381/432 of 1k97A
- active site: D22 (= D15), R106 (= R96), D135 (= D125), S191 (= S177)
- binding aspartic acid: S129 (≠ C119), T130 (= T120), G133 (= G123), N134 (= N124), D135 (= D125)
- binding citrulline: Y98 (= Y88), T102 (= T92), P103 (≠ A93), R138 (= R128), S191 (= S177), T192 (≠ I178), D193 (= D179), T200 (≠ S186), E202 (= E188), E279 (= E262), Y291 (= Y274), Y331 (= Y314)
Query Sequence
>NP_662005.1 NCBI__GCF_000006985.1:NP_662005.1
MSKEKIAVAYSGGLDTSVMIKWLKDKYEGAEIVAVTGNLGQKMEVDNLEQKAIATGAKSF
HFVDLRKTFVEEYIWKALKAGALYEDVYPLATALGRPLLAKALVDVALAEGCTMLTHGCT
GKGNDQVRFEVAFAALAPHMKVVAPLREWEFTSREQEIAYAMEHNIPVSATKKNPYSIDE
NIWGISIECGVLEDPMVAPPADAYQITTAPELAPDEPTVVDIEFAQGVPVALDGQQMEGL
DLIVRLNELGAMNGVGRLDMIENRVVGIKSREIYEAPAATILHFAHRELERLTLEKSVFQ
YKRNIGQDYANLIYNGTWFSPMRKALDAFVDETQKPVTGMVRIKLYKGSMTLLGRTSPNS
LYNEALATYTEADTFDHKSAEGFIKIYGLGLKTFHEVNKSE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory