Comparing PFLU_RS30215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
8wk0N Helicase HerA central domain-containing protein
50% identity, 99% coverage: 2:69/69 of query aligns to 475:542/542 of 8wk0N
Sites not aligning to the query:
8wivD Helicase HerA central domain-containing protein
54% identity, 88% coverage: 9:69/69 of query aligns to 542:602/602 of 8wivD
Sites not aligning to the query:
8wivO Helicase HerA central domain-containing protein
50% identity, 99% coverage: 2:69/69 of query aligns to 590:657/657 of 8wivO
Sites not aligning to the query:
>PFLU_RS30215
MNRDAVSSSNIISVGYDSGSETLEIEFKDGAVYQYYNVSEHLYEQFKASSSKGQFFHIYI
KNAVPFSRV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory