Comparing PP_0137 FitnessBrowser__Putida:PP_0137 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
38% identity, 93% coverage: 10:418/442 of query aligns to 12:423/427 of 5e9sA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
38% identity, 93% coverage: 10:418/442 of query aligns to 9:420/424 of 6zl4A
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
38% identity, 93% coverage: 10:418/442 of query aligns to 12:423/426 of 6xwnB
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
38% identity, 93% coverage: 10:418/442 of query aligns to 10:421/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
37% identity, 93% coverage: 10:418/442 of query aligns to 5:412/416 of 6r7rA
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
36% identity, 91% coverage: 10:412/442 of query aligns to 14:417/425 of O59010
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
35% identity, 93% coverage: 2:412/442 of query aligns to 6:417/419 of 6x15A
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
35% identity, 91% coverage: 10:411/442 of query aligns to 5:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
35% identity, 91% coverage: 10:412/442 of query aligns to 6:409/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
35% identity, 93% coverage: 2:411/442 of query aligns to 3:413/413 of 6x14A
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
35% identity, 91% coverage: 10:411/442 of query aligns to 6:408/408 of 6bauA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
34% identity, 91% coverage: 10:411/442 of query aligns to 6:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
31% identity, 81% coverage: 45:404/442 of query aligns to 57:395/412 of 7awmA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
29% identity, 90% coverage: 13:411/442 of query aligns to 26:460/503 of Q10901
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
30% identity, 89% coverage: 13:404/442 of query aligns to 16:407/424 of 7xr6A
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
30% identity, 89% coverage: 13:404/442 of query aligns to 15:408/425 of 7xr4A
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
31% identity, 81% coverage: 45:404/442 of query aligns to 49:381/397 of 5mjuA
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
28% identity, 90% coverage: 12:407/442 of query aligns to 58:494/543 of P56564
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
29% identity, 89% coverage: 13:407/442 of query aligns to 51:492/572 of P43006
Sites not aligning to the query:
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
28% identity, 89% coverage: 13:407/442 of query aligns to 51:492/573 of P31596
>PP_0137 FitnessBrowser__Putida:PP_0137
MKKAKLSLAWQIVIGLVLGVAIGALLNHFSAEKAWWISNVLQPAGDIFIRLIKMIVVPIV
ISSLIVGIAGVGDAKKLGSIGLKTIIYFEVVTTIAIVVGLVLANLFHPGAGIDMSTLGTV
DISKYQATAAEVQHEHAFIETLLNLIPSNIFAALMRGEMLPIIFFSVMFGLGLSSLQAEL
RDPLVRTFQAVSETMFKVTHMIMNYAPIGVFALIAVTVANFGFSSLLPLAKLVVLVYFAI
AFFAFMVLGLVARLFGFSVIKIMRIMKDELILAYSTSSSETVLPRVIEKMEKYGAPKSIC
SFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSWSQQLLLVLTLMVTSKGIAGVPGVS
FVVLLATLGSVGIPLEGLAFIAGVDRIMDMARTALNVVGNALAALVIARWEGMYDAVKGE
QYYASLMAEKQGAVVVGETAKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory