Comparing PP_0208 FitnessBrowser__Putida:PP_0208 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
8wm8B Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with nitrate (see paper)
36% identity, 67% coverage: 65:237/260 of query aligns to 73:248/265 of 8wm8B
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
28% identity, 54% coverage: 104:244/260 of query aligns to 60:199/506 of A0A0H2ZQB9
Sites not aligning to the query:
>PP_0208 FitnessBrowser__Putida:PP_0208
MTRNLKRWPVRLASLLACLLFWQVAANVKMDLGLLTFTYVPTPKAVLDAAWQLLTSSTLL
AHLGSSLARVFAGYATAALVGVALGLLIGRSKWAEDTLLPPLEVLRPIPAVAWIPLAILM
FPSSELSMVFITFTGALFPILLNTVHGVEAVDPRLVASARSLGAGRWAILREVVLPGALP
SIVTGLAIGMGTSWFCLVTAEMISGQFGIGYYTWESYTLQNYPDIVVGMLLIGVLGMGSS
ALVKRLGALATPWYRTRRAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory