Comparing PP_0220 FitnessBrowser__Putida:PP_0220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
46% identity, 87% coverage: 49:368/369 of query aligns to 20:343/343 of P30750
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
45% identity, 87% coverage: 49:368/369 of query aligns to 21:344/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
45% identity, 87% coverage: 49:368/369 of query aligns to 21:344/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
45% identity, 87% coverage: 49:368/369 of query aligns to 21:344/344 of 3tuiC
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
46% identity, 60% coverage: 50:270/369 of query aligns to 18:236/241 of 4u00A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
43% identity, 61% coverage: 49:273/369 of query aligns to 16:239/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
42% identity, 60% coverage: 50:271/369 of query aligns to 19:239/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
42% identity, 60% coverage: 50:271/369 of query aligns to 19:239/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
42% identity, 60% coverage: 50:271/369 of query aligns to 19:239/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
42% identity, 60% coverage: 50:271/369 of query aligns to 19:239/242 of 2oljA
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
41% identity, 60% coverage: 33:253/369 of query aligns to 2:220/222 of 8i6rB
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
41% identity, 63% coverage: 49:279/369 of query aligns to 375:608/611 of 8j5qD
Sites not aligning to the query:
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
41% identity, 63% coverage: 49:279/369 of query aligns to 375:608/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
41% identity, 63% coverage: 49:279/369 of query aligns to 375:608/608 of 8j5sD
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 59% coverage: 54:270/369 of query aligns to 46:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
38% identity, 59% coverage: 54:270/369 of query aligns to 46:263/382 of 7aheC
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
41% identity, 61% coverage: 33:258/369 of query aligns to 2:232/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
40% identity, 59% coverage: 33:248/369 of query aligns to 2:223/230 of 1l2tA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
44% identity, 54% coverage: 50:248/369 of query aligns to 23:220/226 of 5xu1B
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
42% identity, 58% coverage: 33:246/369 of query aligns to 2:213/219 of 8w6iD
>PP_0220 FitnessBrowser__Putida:PP_0220
MSQASALRAPTPQALPPMAREQALRPDVNEAHVRFIGLGKTYPGQAQPALQGIDLNIRHG
EIFGIIGRSGAGKSSLLRTINRLEQPSQGRVLIDQVDIAPFNEDQLVALRRRIGMIFQHF
NLMSAKTVWQNVELPLKVAGVAKAERQRKVRELLELVGLQEKHHVYPAQLSGGQKQRVGI
ARALVHTPEILLCDEATSALDPETTASILELLRDINQRLGLTIVLITHEMAVIRDICHRV
VVLERGAVVEQGEVWRVFGSPRHEVTRTLLAPLQAKLPAALQASLQAHPASGNSAVVLKL
TVLGEPELSALFNDLGGRVRLLQGGVETIGEHALGQLILSVQHSPHDTHQLLERARRWAE
DVEVLGHVD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory