Comparing PP_0221 FitnessBrowser__Putida:PP_0221 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4qhqA The structure of a nutrient binding protein from burkholderia cenocepacia bound to methionine
39% identity, 85% coverage: 28:254/266 of query aligns to 2:231/241 of 4qhqA
4yahX Crystal structure of the methionine binding protein, metq (see paper)
43% identity, 81% coverage: 49:264/266 of query aligns to 28:243/245 of 4yahX
3tqwA Structure of a abc transporter, periplasmic substrate-binding protein from coxiella burnetii (see paper)
40% identity, 79% coverage: 48:257/266 of query aligns to 24:229/235 of 3tqwA
P04846 Lipoprotein 28 from Escherichia coli (strain K12) (see paper)
40% identity, 76% coverage: 49:251/266 of query aligns to 57:260/272 of P04846
Sites not aligning to the query:
4ntlA Crystal structure of a lipoprotein, yaec family (ef3198) from enterococcus faecalis v583 at 1.80 a resolution
37% identity, 74% coverage: 40:235/266 of query aligns to 17:214/242 of 4ntlA
Sites not aligning to the query:
3k2dA Crystal structure of immunogenic lipoprotein a from vibrio vulnificus (see paper)
39% identity, 77% coverage: 48:251/266 of query aligns to 30:232/237 of 3k2dA
4ib2A Crystal structure of a putative lipoprotein (rumgna_00858) from ruminococcus gnavus atcc 29149 at 1.76 a resolution
36% identity, 68% coverage: 24:203/266 of query aligns to 1:177/247 of 4ib2A
Sites not aligning to the query:
6dzxA Crystal structure of the n. Meningitides methionine-binding protein in its d-methionine bound conformation. (see paper)
41% identity, 54% coverage: 46:189/266 of query aligns to 22:166/240 of 6dzxA
Sites not aligning to the query:
3gxaC Crystal structure of gna1946 (see paper)
41% identity, 54% coverage: 46:189/266 of query aligns to 23:167/244 of 3gxaC
Sites not aligning to the query:
1p99A 1.7a crystal structure of protein pg110 from staphylococcus aureus (see paper)
34% identity, 84% coverage: 30:252/266 of query aligns to 4:229/255 of 1p99A
1xs5A The crystal structure of lipoprotein tp32 from treponema pallidum (see paper)
35% identity, 61% coverage: 26:188/266 of query aligns to 3:166/240 of 1xs5A
Sites not aligning to the query:
6jf1A Crystal structure of the substrate binding protein of a methionine transporter from streptococcus pneumoniae (see paper)
30% identity, 81% coverage: 49:264/266 of query aligns to 37:260/260 of 6jf1A
Sites not aligning to the query:
4oteB Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
30% identity, 73% coverage: 48:241/266 of query aligns to 27:218/240 of 4oteB
>PP_0221 FitnessBrowser__Putida:PP_0221
MLEKLFRPVAAIAIILGLCAGALAAEPLKIGTTSAFAIPLEAAVEEAHKQGLEVKLIEFS
DWIAPNVSLNSGDIDVNYFQHIPFLENAKAAAGFNLVPYAPGIINNVGLYSKKYKSFAEL
PEGASVAIANDPINSGRGLLLLAKAGLITLKPGVGYKATEADILANPKKLKILQVEAVQL
VRAYDDADLVQGYPAYIRLANTFDATSALLFDGLENKEYVIQFVIRPQSKDDPRLAKFVD
IYQHSPVVRAALNKAHGKLYQAGWEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory