Comparing PP_0227 FitnessBrowser__Putida:PP_0227 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
46% identity, 84% coverage: 37:259/264 of query aligns to 3:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
46% identity, 84% coverage: 37:259/264 of query aligns to 3:226/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
43% identity, 86% coverage: 31:258/264 of query aligns to 3:228/229 of 5t0wA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
38% identity, 91% coverage: 25:263/264 of query aligns to 1:238/240 of 2ylnA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
37% identity, 90% coverage: 26:262/264 of query aligns to 1:234/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
37% identity, 90% coverage: 26:262/264 of query aligns to 5:238/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
37% identity, 90% coverage: 26:262/264 of query aligns to 5:238/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
37% identity, 90% coverage: 26:262/264 of query aligns to 5:238/241 of 3vvdA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
36% identity, 85% coverage: 34:258/264 of query aligns to 6:227/229 of 6svfA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
33% identity, 84% coverage: 37:258/264 of query aligns to 3:226/234 of 3k4uE
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
36% identity, 84% coverage: 38:258/264 of query aligns to 1:222/224 of 4ymxA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
35% identity, 82% coverage: 42:257/264 of query aligns to 18:233/235 of 4g4pA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
32% identity, 85% coverage: 40:263/264 of query aligns to 4:253/256 of 5otcA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
32% identity, 85% coverage: 40:263/264 of query aligns to 4:253/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
32% identity, 85% coverage: 40:263/264 of query aligns to 4:253/254 of 5ot9A
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
32% identity, 85% coverage: 40:263/264 of query aligns to 4:253/254 of 4powA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
32% identity, 85% coverage: 40:263/264 of query aligns to 5:254/259 of 5ovzA
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
32% identity, 85% coverage: 40:263/264 of query aligns to 5:254/255 of 5itoA
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
33% identity, 85% coverage: 40:263/264 of query aligns to 10:266/267 of 8hqrA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
31% identity, 83% coverage: 42:261/264 of query aligns to 7:224/226 of 8eyzA
>PP_0227 FitnessBrowser__Putida:PP_0227
MSKFAKPLLNASLALLLGAGLLSQAFAGEQLKTIQEKGVINVGLEGTYPPFSFQDENGKL
TGFEVELSELLAKELGVKAKIQPTKWDGILAALESKRLDVVVNQVTISEERKKKYDFSEP
YTVSGIQALILKKKAEQLNIKGAQDLAGKKVGVGLGTNYEQWVKKDVPQADVRTYEDDPS
KFADLRNGRIDAILIDRLAALEYAQKAKDTELAGDAFSRLESGVALRKGEPELLAAINKA
IDKLKADGTLAKLSEKYFGADVTK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory