SitesBLAST
Comparing PP_0284 FitnessBrowser__Putida:PP_0284 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P46349 Gamma-aminobutyric acid permease; GABA permease; 4-aminobutyrate permease; Gamma-aminobutyrate permease; Proline transporter GabP from Bacillus subtilis (strain 168) (see paper)
52% identity, 99% coverage: 4:460/461 of query aligns to 3:458/469 of P46349
- G33 (= G34) mutation to D: Lack of activity.
- G42 (= G43) mutation to S: Lack of activity.
- G301 (≠ A303) mutation to V: Lack of activity.
- G338 (≠ S340) mutation to E: Lack of activity.
- F341 (≠ A343) mutation to S: Lack of activity.
- G414 (≠ A415) mutation to R: Lack of activity.
P24207 Phenylalanine-specific permease; Phenylalanine:H(+) symporter PheP from Escherichia coli (strain K12) (see 3 papers)
38% identity, 92% coverage: 4:427/461 of query aligns to 14:435/458 of P24207
- R26 (= R16) mutation R->G,S,Q: Strong decrease in phenylalanine transport activity.
- P54 (= P44) mutation to A: 50% of wild-type phenylalanine transport activity.; mutation to G: No change in phenylalanine transport activity.; mutation to L: 26% of wild-type phenylalanine transport activity.
- F87 (= F77) mutation to L: No effect on phenylalanine transport activity.
- F90 (≠ Y80) mutation to L: 65% of wild-type phenylalanine transport activity.
- Y92 (≠ D82) mutation to L: 41% of wild-type phenylalanine transport activity.
- Y94 (≠ A84) mutation to L: 69% of wild-type phenylalanine transport activity.
- W95 (≠ I85) mutation to L: 10% of wild-type phenylalanine transport activity.
- F98 (≠ W88) mutation to L: No effect on phenylalanine transport activity.
- F101 (= F91) mutation to L: 38% of wild-type phenylalanine transport activity.
- W105 (= W95) mutation to L: 39% of wild-type phenylalanine transport activity.
- Y107 (= Y97) mutation to L: No effect on phenylalanine transport activity.
- W108 (= W98) mutation to L: 71% of wild-type phenylalanine transport activity.
- F111 (≠ W101) mutation to L: 60% of wild-type phenylalanine transport activity.; mutation to Y: Enables the transport of tryptophan to almost the same steady-state level as that of phenylalanine.
- E118 (= E108) mutation E->G,L,V,N: Loss of activity.
- K168 (= K158) mutation K->L,R: Strong decrease in phenylalanine transport activity.; mutation to N: Loss of activity.
- E226 (= E217) mutation E->A,Q,K,R,W: Loss of activity.
- R252 (= R243) mutation R->D,E,F,W,P: Loss of activity.
- P341 (= P333) mutation to A: 5% of wild-type phenylalanine transport activity.; mutation P->G,Q,K,R: Loss of activity.; mutation to S: 3% of wild-type phenylalanine transport activity.; mutation to T: 17% of wild-type phenylalanine transport activity.
Sites not aligning to the query:
- 442 P→A: 46% of wild-type phenylalanine transport activity.; P→G: 52% of wild-type phenylalanine transport activity.; P→L: 43% of wild-type phenylalanine transport activity.
P15993 Aromatic amino acid transport protein AroP; Aromatic amino acid:H(+) symporter AroP; General aromatic amino acid permease; General aromatic transport system from Escherichia coli (strain K12) (see paper)
37% identity, 91% coverage: 1:420/461 of query aligns to 2:420/457 of P15993
- Y103 (≠ W101) Key residue for tryptophan transport; mutation to F: Decreases tryptophan transport to less than 50% of wild-type levels and reduces the ability of tryptophan to inhibit phenylalanine transport from 95 to 62%.
P25737 Lysine-specific permease LysP; Lysine transporter LysP; Trigger transporter LysP from Escherichia coli (strain K12) (see 2 papers)
35% identity, 90% coverage: 9:425/461 of query aligns to 13:438/489 of P25737
- Y102 (= Y97) mutation to L: Retains 4% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- W106 (= W101) mutation to L: Retains 20% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- K163 (= K158) mutation to A: Retains 24% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- F216 (= F211) mutation to L: Retains 13% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- E222 (= E217) mutation to A: Abolishes lysine uptake. Strongly inhibits CadC.
- E230 (= E225) mutation to V: Abolishes lysine uptake. Shows significant less inhibition of CadC.
- D275 (vs. gap) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-278.
- D278 (vs. gap) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-275.
- E438 (≠ D425) mutation to A: Retains 14% of wild-type lysine uptake activity. Is unable to inhibit CadC.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 443 D→A: Retains 11% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 446 D→A: Retains 13% of wild-type lysine uptake activity. Is unable to inhibit CadC.
P04817 Arginine permease CAN1; Canavanine resistance protein 1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 90% coverage: 8:422/461 of query aligns to 83:515/590 of P04817
- P113 (≠ A38) mutation to L: In CAN1-343; confers citrulline transport activity in GAP1-deleted cells.
- P148 (= P72) mutation to L: In CAN1-337; confers citrulline transport activity in GAP1-deleted cells and leads to sensitivity to L-glutamic acid alpha-hydroxamate, alpha-aminoisobutyrate, 3-chloro-L-alanine, L-ethionine, L-allylglycine, and D-histidine, but not sensitivity to L-aspartic acid alpha-hydroxamate or p-fluoro-L-phenylalanine.
- V149 (≠ D73) mutation to F: In CAN1-315; confers citrulline transport activity in GAP1-deleted cells.
- S152 (= S76) mutation to F: In CAN1-342; confers citrulline transport activity in GAP1-deleted cells.
- Y173 (= Y97) mutation to D: In CAN1-306; confers citrulline transport activity in GAP1-deleted cells.; mutation to H: In CAN1-327; confers citrulline transport activity in GAP1-deleted cells.
- G308 (≠ A224) mutation to A: In CAN1-341; confers citrulline transport activity in GAP1-deleted cells.
- P313 (= P229) mutation to S: In CAN1-329; confers citrulline transport activity in GAP1-deleted cells and leads to sensitivity to L-glutamic acid alpha-hydroxamate, alpha-aminoisobutyrate, 3-chloro-L-alanine, L-ethionine, L-allylglycine, and D-histidine, L-aspartic acid alpha-hydroxamate and p-fluoro-L-phenylalanine.
- TS 354:355 (≠ GS 270:271) mutation Missing: In CAN1-318; confers citrulline transport activity in GAP1-deleted cells.
- Y356 (= Y272) mutation to H: In CAN1-340; confers citrulline transport activity in GAP1-deleted cells.; mutation to N: In CAN1-339; confers citrulline transport activity in GAP1-deleted cells.
- W451 (≠ F361) mutation to C: In CAN1-328; confers citrulline transport activity in GAP1-deleted cells.; mutation to L: In CAN1-316; confers citrulline transport activity in GAP1-deleted cells.; mutation to S: In CAN1-335; confers citrulline transport activity in GAP1-deleted cells.
- F461 (≠ L371) mutation to S: In CAN1-307; confers citrulline transport activity in GAP1-deleted cells.
P19145 General amino-acid permease GAP1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
33% identity, 96% coverage: 9:449/461 of query aligns to 86:548/602 of P19145
- A297 (≠ M214) mutation to V: Impairs basic amino-acids transport and regulation by these amino-acids.
Sites not aligning to the query:
- 76 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q9URZ4 Cationic amino acid transporter 1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 91% coverage: 2:421/461 of query aligns to 73:503/587 of Q9URZ4
Sites not aligning to the query:
- 29 modified: Phosphoserine
- 30 modified: Phosphoserine
- 37 modified: Phosphoserine
P48813 High-affinity glutamine permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 85% coverage: 4:395/461 of query aligns to 140:544/663 of P48813
Sites not aligning to the query:
- 132 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q03770 SPS-sensor component SSY1; Amino-acid permease homolog SSY1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 86% coverage: 9:403/461 of query aligns to 277:746/852 of Q03770
- T382 (≠ A113) mutation T->H,L: Constitutively active, up-regulates amino acid permease transcription in response to subthreshold concentrations of amino acids.; mutation to K: In SSY1-102; constitutively active, up-regulates amino acid permease transcription in the absence of amino-acids.; mutation to R: Constitutively active, up-regulates amino acid permease transcription in the absence of amino acids.
O34739 Serine/threonine exchanger SteT from Bacillus subtilis (strain 168) (see paper)
23% identity, 87% coverage: 4:403/461 of query aligns to 3:390/438 of O34739
- C94 (≠ I93) mutation to S: Retains 25% of the transport activity; when associated with S-141; S-168; S-291 and S-415.
- C141 (≠ T137) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-168; S-291 and S-415.
- C168 (= C170) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-291 and S-415.
- C291 (= C299) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-415.
Sites not aligning to the query:
- 415 C→S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-291.
P76037 Putrescine importer PuuP from Escherichia coli (strain K12) (see paper)
23% identity, 86% coverage: 9:403/461 of query aligns to 18:405/461 of P76037
- Y110 (≠ W101) mutation to X: The uptake activity is reduced to one-eighth of that of wild-type.
6f34A Crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. (see paper)
24% identity, 86% coverage: 2:397/461 of query aligns to 16:409/458 of 6f34A
- binding arginine: I40 (≠ V26), G42 (= G28), T43 (≠ A29), G44 (= G30), E115 (≠ V104), Y116 (≠ I105), A119 (≠ E108), F228 (= F211), A229 (≠ S212), I231 (≠ M214), V314 (≠ C299)
- binding cholesterol: W201 (≠ F174), Y202 (≠ G175)
- binding : G28 (≠ K14), F30 (≠ R16), D31 (≠ H17), M34 (= M20), A178 (≠ G148), R179 (≠ E149), A186 (≠ L156), I187 (≠ L157), A190 (≠ L160), L194 (≠ G164), Q296 (≠ V281), V299 (≠ A284)
5oqtA Crystal structure of a bacterial cationic amino acid transporter (cat) homologue (see paper)
24% identity, 86% coverage: 2:397/461 of query aligns to 14:407/456 of 5oqtA
- binding alanine: I38 (≠ V26), G40 (= G28), T41 (≠ A29), G42 (= G30), F226 (= F211), A227 (≠ S212), I229 (≠ M214)
- binding : E24 (≠ G12), G26 (≠ K14), F28 (≠ R16), D29 (≠ H17), M32 (= M20), A176 (≠ G148), R177 (≠ E149), A184 (≠ L156), A188 (≠ L160), L192 (≠ G164), Q294 (≠ V281), V297 (≠ A284)
Q9UHI5 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; hLAT2; Solute carrier family 7 member 8 from Homo sapiens (Human) (see 3 papers)
26% identity, 83% coverage: 23:403/461 of query aligns to 50:427/535 of Q9UHI5
- I53 (≠ V26) binding
- Y93 (≠ L64) mutation to A: Nearly complete reduction of glycine, L-alanine, and L-glutamine uptake. Minimal effect on the transport of L-isoleucine, L-histidine and L-tryptophan.
- N134 (≠ A109) Important for substrate specificity; binding ; mutation to Q: Reduces L-leucine uptake activity. Abolishes L-tryptophan uptake.; mutation to S: The substrate specificity changed dramatically reducing L-glutamine, glycine and L-alanine uptake activity thus mimicking the selectivity of SLC7A5.
- C154 (≠ V123) modified: Interchain (with C-210 in SLC3A2)
- W174 (≠ L138) mutation to A: Does not affect protein expression, plasma membrane localization, or L-alanine uptake.
- F243 (= F211) mutation to A: Abolishes leucine and tryptophan transport activities.
- G246 (≠ M214) Important for substrate specificity; binding ; mutation to S: Strong decrease in the uptake of large substrates L-tryptophan, L-glutamine, and L-histidine but increases the uptake of small neutral amino acids glycine and L-alanine.
- V302 (≠ S271) to I: found in a patient with age-related hearing loss; does not affect L-alanine transport activity. Decreases L-tyrosine transport activity
- N395 (≠ A370) binding ; mutation to Q: Strongly reduces L-leucine uptake activity. Strongly reduces L-tryptophan uptake activity.
- Y396 (≠ L371) mutation to A: Strongly reduces L-leucine uptake activity.
- T402 (≠ I377) to M: found in a patient with age-related hearing loss; strongly decreased L-alanine transport activity. Decreases L-tyrosine transport activity
- R418 (≠ E393) to C: found in a patient with age-related hearing loss; decreases L-alanine transport activity. Decreases L-tyrosine transport activity
Sites not aligning to the query:
- 460 V → E: found in a patient with age-related hearing loss; strongly decreases L-alanine transport activity. Decreases L-tyrosine transport activity. Decreases cell membrane localization
P30825 High affinity cationic amino acid transporter 1; CAT-1; CAT1; Ecotropic retroviral leukemia receptor homolog; Ecotropic retrovirus receptor homolog; Solute carrier family 7 member 1; System Y+ basic amino acid transporter from Homo sapiens (Human) (see paper)
24% identity, 83% coverage: 9:389/461 of query aligns to 28:435/629 of P30825
- N226 (≠ Q181) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7b00A Human lat2-4f2hc complex in the apo-state (see paper)
26% identity, 83% coverage: 23:403/461 of query aligns to 10:387/457 of 7b00A
Sites not aligning to the query:
7cmiB The lat2-4f2hc complex in complex with leucine (see paper)
26% identity, 83% coverage: 23:403/461 of query aligns to 10:387/458 of 7cmiB
7cmhB The lat2-4f2hc complex in complex with tryptophan (see paper)
26% identity, 83% coverage: 23:403/461 of query aligns to 10:387/458 of 7cmhB
Q9QXW9 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; mLAT2; Solute carrier family 7 member 8 from Mus musculus (Mouse) (see paper)
25% identity, 83% coverage: 23:403/461 of query aligns to 49:426/531 of Q9QXW9
- Y130 (≠ P106) mutation to A: Increases T2 import. Increases T3 and enables T4 import. Does not affect L-leucine and L-phenylalanine uptake.
- N133 (≠ A109) mutation to S: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake. Increases the export of both L-leucine and L-phenylalanine.
- F242 (= F211) mutation to W: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake.
6f2wA Bacterial asc transporter crystal structure in open to in conformation (see paper)
27% identity, 46% coverage: 26:235/461 of query aligns to 17:223/433 of 6f2wA
Query Sequence
>PP_0284 FitnessBrowser__Putida:PP_0284
MSGNNSNDLAQGLKQRHVTMLSIAGVIGAGLFVGSGHAIAAAGPAVLLAYAAAGTLVVLV
MRMLGEMAVASPDTGSFSTYADRAIGRWAGFTIGWLYWWFWVLVIPLEANAAAAILHAWF
PAVDLWAFSLIITLALTLTNLCSVKNYGEFEFWFALLKVLAIIGFIAVGCAALFGFVPSS
QVSGTSHLFDTQGFMPNGLGAVLAAMLTTMFSFMGTEIVTIAAAESKDPGKQISRATNSV
IWRICLFYLVSIFLVVALVPWNDPALAETGSYQTVLSRIGVPNAKLIVDIVVLIAVTSCL
NSALYTSSRMLFSLSKRGDAPAIAQRTTKAATPHVAVLLSTAAAFLCVFANFVAPAQVFE
FLLASSGAIALLVYLVIAVSQLRMRAQREARGEKITFKMWLFPGLTWATIAFIVAILVVM
ALREDHRAEIIATALLSIGVVAAGLLVHRKREAAGRAALDS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory