Comparing PP_0422 FitnessBrowser__Putida:PP_0422 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6y88B Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
84% identity, 95% coverage: 2:265/277 of query aligns to 1:264/265 of 6y88B
6y88G Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
84% identity, 88% coverage: 25:267/277 of query aligns to 15:253/253 of 6y88G
3t55A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba)
41% identity, 91% coverage: 5:256/277 of query aligns to 1:247/258 of 3t55A
3t44A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with indole glycerol phosphate (igp) amd anthranilate
41% identity, 91% coverage: 5:256/277 of query aligns to 1:247/259 of 3t44A
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
39% identity, 95% coverage: 5:268/277 of query aligns to 3:257/452 of 1piiA
Sites not aligning to the query:
1jcmP Trpc stability mutant containing an engineered disulphide bridge and in complex with a cdrp-related substrate (see paper)
39% identity, 95% coverage: 5:268/277 of query aligns to 3:257/259 of 1jcmP
3t78A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate
40% identity, 91% coverage: 5:256/277 of query aligns to 1:245/257 of 3t78A
7etxA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum (see paper)
37% identity, 97% coverage: 2:269/277 of query aligns to 2:262/472 of 7etxA
Sites not aligning to the query:
7etyA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum in complex with reduced 1-(o-carboxyphenylamino)-1- deoxyribulose 5-phosphate (rcdrp) (see paper)
37% identity, 96% coverage: 3:269/277 of query aligns to 1:260/470 of 7etyA
Sites not aligning to the query:
1vc4B Crystal structure of indole-3-glycerol phosphate synthase (trpc) from thermus thermophilus at 1.8 a resolution (see paper)
40% identity, 93% coverage: 3:259/277 of query aligns to 8:246/254 of 1vc4B
3t40A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg)
38% identity, 91% coverage: 5:256/277 of query aligns to 1:233/251 of 3t40A
1lbfA Crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) (see paper)
36% identity, 74% coverage: 47:252/277 of query aligns to 36:237/247 of 1lbfA
Sites not aligning to the query:
1jukA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a trigonal crystal form (see paper)
36% identity, 74% coverage: 47:252/277 of query aligns to 36:237/247 of 1jukA
1igsA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus at 2.0 a resolution (see paper)
36% identity, 74% coverage: 47:252/277 of query aligns to 36:237/247 of 1igsA
1a53A Complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution (see paper)
36% identity, 74% coverage: 47:252/277 of query aligns to 36:237/247 of 1a53A
4iwwA Computational design of an unnatural amino acid metalloprotein with atomic level accuracy (see paper)
34% identity, 74% coverage: 47:252/277 of query aligns to 36:237/247 of 4iwwA
4ou1A Crystal structure of a computationally designed retro-aldolase covalently bound to folding probe 1 [(6-methoxynaphthalen-2-yl) (oxiran-2-yl)methanol] (see paper)
30% identity, 82% coverage: 47:274/277 of query aligns to 36:247/247 of 4ou1A
5k7jA Structure of designed zinc binding protein ze2 bound to zn2+ (see paper)
33% identity, 74% coverage: 47:252/277 of query aligns to 36:230/240 of 5k7jA
3uzjA Designed protein ke59 r13 3/11h with benzotriazole (see paper)
30% identity, 82% coverage: 47:274/277 of query aligns to 36:247/247 of 3uzjA
3uz5A Designed protein ke59 r13 3/11h (see paper)
30% identity, 82% coverage: 47:274/277 of query aligns to 36:247/247 of 3uz5A
>PP_0422 FitnessBrowser__Putida:PP_0422
MSVPTVLERIIARKFQEVAERSAHVSLAELEGLAKAADAPRGFANALIEQAKRKQPAVIA
EIKKASPSKGVIREHFVPAEIAVSYEKGGATCLSVLTDVDYFQGADEYLQQARAAVSLPV
IRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAATAKDVGLDVLVEVHDGDELE
RALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRDRLAITESGILNRADVELMAINE
VYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQQLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory