Comparing PP_0495 FitnessBrowser__Putida:PP_0495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A962 L-asparaginase 1; L-asparaginase I; L-ASNase I; L-asparagine amidohydrolase I; EC 3.5.1.1 from Escherichia coli (strain K12) (see paper)
36% identity, 98% coverage: 5:327/329 of query aligns to 4:333/338 of P0A962
6nxcB Ecai(t162a) mutant in complex with citrate at ph 4 (see paper)
35% identity, 98% coverage: 5:327/329 of query aligns to 11:332/336 of 6nxcB
2himA Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i (see paper)
35% identity, 98% coverage: 5:327/329 of query aligns to 2:321/324 of 2himA
4r8lA Crystal structure of the asp-bound guinea pig l-asparaginase 1 catalytic domain (see paper)
34% identity, 98% coverage: 5:327/329 of query aligns to 2:350/354 of 4r8lA
5dndD Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t116a (see paper)
34% identity, 98% coverage: 5:327/329 of query aligns to 2:350/357 of 5dndD
7r6bB Crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis (see paper)
33% identity, 98% coverage: 5:327/329 of query aligns to 2:298/301 of 7r6bB
5ot0A The thermostable l-asparaginase from thermococcus kodakarensis (see paper)
33% identity, 98% coverage: 6:327/329 of query aligns to 2:324/328 of 5ot0A
Q8TZE8 L-asparaginase; EC 3.5.1.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
29% identity, 82% coverage: 59:327/329 of query aligns to 50:323/326 of Q8TZE8
Sites not aligning to the query:
4q0mA Crystal structure of pyrococcus furiosus l-asparaginase (see paper)
29% identity, 82% coverage: 59:327/329 of query aligns to 51:324/327 of 4q0mA
Sites not aligning to the query:
1zq1A Structure of gatde tRNA-dependent amidotransferase from pyrococcus abyssi (see paper)
29% identity, 81% coverage: 61:327/329 of query aligns to 145:425/437 of 1zq1A
Sites not aligning to the query:
5b5uA Crystal structure of truncated pyrococcus furiosus l-asparaginase with peptide (see paper)
38% identity, 36% coverage: 59:178/329 of query aligns to 50:166/175 of 5b5uA
Sites not aligning to the query:
4njeA Crystal structure of pyrococcus furiosus l-asparaginase with ligand (see paper)
38% identity, 36% coverage: 59:178/329 of query aligns to 50:166/182 of 4njeA
Sites not aligning to the query:
8h4aB Blasnase-t13a/m57p
23% identity, 97% coverage: 5:323/329 of query aligns to 2:323/328 of 8h4aB
7c8qA Blasnase-t13a with d-asn (see paper)
23% identity, 93% coverage: 5:309/329 of query aligns to 2:310/321 of 7c8qA
7c8xA Blasnase-t13a with l-asn (see paper)
23% identity, 93% coverage: 5:309/329 of query aligns to 2:309/319 of 7c8xA
7cbuA Blasnase-t13a with l-asp (see paper)
23% identity, 93% coverage: 5:309/329 of query aligns to 2:307/318 of 7cbuA
2wltA The crystal structure of helicobacter pylori l-asparaginase at 1.4 a resolution (see paper)
23% identity, 80% coverage: 9:272/329 of query aligns to 6:279/326 of 2wltA
Sites not aligning to the query:
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
21% identity, 82% coverage: 6:275/329 of query aligns to 3:261/306 of 7r5qA
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
22% identity, 65% coverage: 61:275/329 of query aligns to 80:303/348 of P00805
Sites not aligning to the query:
1hg1A X-ray structure of the complex between erwinia chrysanthemi l-asparaginase and d-aspartate (see paper)
28% identity, 52% coverage: 6:177/329 of query aligns to 3:158/306 of 1hg1A
>PP_0495 FitnessBrowser__Putida:PP_0495
MRAVKNLLVLYTGGTIGMLETPEGLAPAGGFEARMREHFAQMANAPQVQWTLHELNPLLD
SANMQQHNWLAMRDAIVAAVDVAGHDGVLVLHGTDSMAYSAAALSFLLLDLPAPVVLTGS
MLPAGVPDSDAWDNLCGALRQFEHGLEDGVQLYFHGQLLHGCRASKLRSEAFDAFAALPR
HRDAERADTIPAELGYKQPRKPVNLAVVPVFPGLQAGHLQALIDSGVQGLLLECYGSGTG
PSDDQALLNVLSTARQRGVMLAAISQCPEGSVVFDTYAAGNRLRGAGLVSGGGMTREAAL
GKMVALLGAGLDADAADRWFVLDLCGERA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory