SitesBLAST
Comparing PP_0552 FitnessBrowser__Putida:PP_0552 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ie0B X-ray crystal structure of 2r,3r-butanediol dehydrogenase from bacillus subtilis
42% identity, 97% coverage: 9:359/362 of query aligns to 2:346/347 of 6ie0B
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
34% identity, 95% coverage: 16:358/362 of query aligns to 12:344/347 of 5vm2A
- active site: C39 (= C46), G40 (= G47), S41 (= S48), H44 (= H51), H65 (= H79), E66 (= E80), C95 (= C109), C98 (= C112), C101 (= C115), C109 (= C123), D113 (≠ A127), P153 (= P165), G157 (= G169), K340 (= K354)
- binding magnesium ion: H65 (= H79), E66 (= E80), E152 (= E164)
- binding zinc ion: C95 (= C109), C98 (= C112), C101 (= C115), C109 (= C123)
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
32% identity, 96% coverage: 11:358/362 of query aligns to 4:345/348 of 1e3jA
- active site: C38 (= C46), G39 (= G47), S40 (= S48), H43 (= H51), H63 (= H79), E64 (= E80), C93 (= C109), C96 (= C112), C99 (= C115), C107 (= C123), T111 (≠ A127), P150 (= P165), G154 (= G169), K341 (= K354)
- binding phosphate ion: A174 (= A189), A196 (≠ E212), R197 (≠ M213), S198 (= S214), R201 (= R217)
- binding zinc ion: C38 (= C46), H63 (= H79), E64 (= E80), C93 (= C109), C96 (= C112), C99 (= C115), C107 (= C123)
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
35% identity, 90% coverage: 13:339/362 of query aligns to 7:327/351 of 3qe3A
- active site: C39 (= C46), G40 (= G47), S41 (= S48), H44 (= H51), H64 (= H79), E65 (= E80), R94 (≠ C109), D97 (≠ C112), C100 (= C115), S108 (≠ C123), F112 (≠ A127), P151 (= P165), G155 (= G169)
- binding glycerol: Y45 (≠ E52), F54 (= F59), T116 (≠ L131), R293 (≠ A305)
- binding zinc ion: C39 (= C46), H64 (= H79), E65 (= E80)
Sites not aligning to the query:
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
34% identity, 90% coverage: 13:339/362 of query aligns to 13:333/357 of Q00796
- C45 (= C46) binding
- H70 (= H79) binding
- E71 (= E80) binding
- R110 (≠ L119) to P: in SORDD; results in protein aggregation
- H135 (≠ V143) to R: in SORDD; results in protein aggregation
- A153 (= A161) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I192) binding
- D204 (≠ E212) binding
- R209 (= R217) binding
- Q239 (≠ G247) to L: in dbSNP:rs1042079
- N269 (≠ K275) to T: in dbSNP:rs930337
- VGL 273:275 (≠ VGI 279:281) binding
- VFR 297:299 (≠ ALA 303:305) binding
- V322 (= V328) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pl6A Human sdh/nadh/inhibitor complex (see paper)
34% identity, 90% coverage: 13:339/362 of query aligns to 12:332/356 of 1pl6A
- active site: C44 (= C46), G45 (= G47), S46 (= S48), H49 (= H51), H69 (= H79), E70 (= E80), R99 (≠ C109), D102 (≠ C112), C105 (= C115), S113 (≠ C123), F117 (≠ A127), P156 (= P165), G160 (= G169)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C46), S46 (= S48), I56 (≠ V58), F59 (= F59), H69 (= H79), E155 (= E164), L274 (≠ I281), F297 (≠ L304)
- binding nicotinamide-adenine-dinucleotide: G181 (= G190), P182 (≠ T191), I183 (= I192), D203 (≠ E212), L204 (≠ M213), R208 (= R217), C249 (= C256), T250 (≠ I257), V272 (= V279), G273 (= G280), L274 (≠ I281), F297 (≠ L304), R298 (≠ A305)
- binding zinc ion: C44 (= C46), H69 (= H79)
Sites not aligning to the query:
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
35% identity, 90% coverage: 13:339/362 of query aligns to 11:330/354 of P07846
- C43 (= C46) binding
- Y49 (= Y53) binding
- H67 (= H79) binding
- E68 (= E80) binding
- E153 (= E164) binding
- R296 (≠ A305) binding
- Y297 (= Y306) binding
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
33% identity, 86% coverage: 31:343/362 of query aligns to 27:333/348 of O58389
- C42 (= C46) binding
- T44 (≠ S48) mutation to A: Total loss of enzymatic activity.
- H67 (= H79) binding
- E68 (= E80) binding
- C97 (= C109) binding
- C100 (= C112) binding
- C103 (= C115) binding
- C111 (= C123) binding
- E152 (= E164) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I192) binding
- E199 (= E212) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R217) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ VGI 279:281) binding
- IT 291:292 (vs. gap) binding
- R294 (vs. gap) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
33% identity, 86% coverage: 31:343/362 of query aligns to 25:331/346 of 2dfvA
- active site: C40 (= C46), G41 (= G47), T42 (≠ S48), H45 (= H51), H65 (= H79), E66 (= E80), C95 (= C109), C98 (= C112), C101 (= C115), C109 (= C123), K113 (≠ A127), P151 (= P165), A155 (≠ G169)
- binding nicotinamide-adenine-dinucleotide: G175 (= G190), P176 (≠ T191), L177 (≠ I192), E197 (= E212), P198 (≠ M213), R202 (= R217), F241 (≠ C256), S242 (≠ I257), A244 (≠ N259), L264 (≠ V279), G265 (= G280), L266 (≠ I281), I289 (vs. gap), T290 (vs. gap)
- binding zinc ion: C95 (= C109), C101 (= C115), C109 (= C123)
Sites not aligning to the query:
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
32% identity, 90% coverage: 13:339/362 of query aligns to 13:333/357 of P27867
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
32% identity, 91% coverage: 6:336/362 of query aligns to 1:322/343 of 4ej6A
- active site: C40 (= C46), G41 (= G47), T42 (≠ S48), H45 (= H51), H61 (= H79), E62 (= E80), C91 (= C109), C94 (= C112), C97 (= C115), C105 (= C123), R109 (≠ A127), P147 (= P165), C151 (≠ G169)
- binding zinc ion: C91 (= C109), C94 (= C112), C97 (= C115), C105 (= C123)
Sites not aligning to the query:
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
32% identity, 91% coverage: 6:336/362 of query aligns to 1:322/342 of 4ejmA
- active site: C40 (= C46), G41 (= G47), T42 (≠ S48), H45 (= H51), H61 (= H79), E62 (= E80), C91 (= C109), C94 (= C112), C97 (= C115), C105 (= C123), R109 (≠ A127), P147 (= P165), C151 (≠ G169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G188), G172 (= G190), V173 (≠ T191), I174 (= I192), T194 (≠ E212), R195 (≠ M213), Q196 (≠ S214), K199 (≠ R217), C240 (= C256), E245 (≠ H261), T246 (= T262), L263 (≠ V279), V265 (≠ I281), I291 (≠ A305)
- binding zinc ion: C91 (= C109), C94 (= C112), C97 (= C115), C105 (= C123)
Sites not aligning to the query:
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
31% identity, 86% coverage: 31:343/362 of query aligns to 25:331/347 of 3gfbA
- active site: C40 (= C46), G41 (= G47), T42 (≠ S48), H45 (= H51), H65 (= H79), E66 (= E80), C95 (= C109), C98 (= C112), C101 (= C115), C109 (= C123), K113 (≠ A127), P151 (= P165), A155 (≠ G169)
- binding nicotinamide-adenine-dinucleotide: G173 (= G188), G175 (= G190), P176 (≠ T191), L177 (≠ I192), S196 (≠ L211), E197 (= E212), P198 (≠ M213), R202 (= R217), F241 (≠ C256), S242 (≠ I257), A244 (≠ N259), L264 (≠ V279), G265 (= G280), L266 (≠ I281), I289 (vs. gap), T290 (vs. gap)
Sites not aligning to the query:
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
31% identity, 86% coverage: 31:343/362 of query aligns to 27:333/350 of Q5JI69
- L179 (≠ I192) binding
- E199 (= E212) binding
- R204 (= R217) binding
- LGL 266:268 (≠ VGI 279:281) binding
- IT 291:292 (vs. gap) binding
2eerB Structural study of project id st2577 from sulfolobus tokodaii strain7
32% identity, 93% coverage: 20:357/362 of query aligns to 13:346/347 of 2eerB
- active site: C38 (= C46), H39 (≠ G47), S40 (= S48), H43 (= H51), H68 (= H79), E69 (= E80), E98 (≠ C109), C101 (= C112), C104 (= C115), C112 (= C123), R116 (≠ A127), C154 (≠ E164), T158 (≠ V168), R342 (≠ V353)
- binding nicotinamide-adenine-dinucleotide: C38 (= C46), H39 (≠ G47), S40 (= S48), H43 (= H51), C154 (≠ E164), T158 (≠ V168), G178 (= G188), G181 (≠ T191), G182 (vs. gap), L183 (≠ I192), D203 (≠ E212), V204 (≠ M213), R205 (≠ S214), L247 (≠ C256), N248 (≠ I257), V270 (= V279), G271 (= G280), L272 (≠ I281), F273 (= F282), L295 (= L304), V296 (≠ A305), R342 (≠ V353)
- binding zinc ion: E98 (≠ C109), C101 (= C112), C104 (= C115), C112 (= C123)
4uejA Closed state of galactitol-1-phosphate 5-dehydrogenase from e. Coli in complex with glycerol. (see paper)
30% identity, 91% coverage: 9:339/362 of query aligns to 1:328/346 of 4uejA
- active site: C38 (= C46), G39 (= G47), S40 (= S48), P43 (≠ H51), H59 (= H79), E60 (= E80), C89 (= C109), C92 (= C112), C95 (= C115), C103 (= C123), D107 (≠ A127), P145 (= P165), G149 (= G169)
- binding glycerol: H59 (= H79), E144 (= E164)
- binding zinc ion: C89 (= C109), C92 (= C112), C95 (= C115), C103 (= C123)
Sites not aligning to the query:
4a2cA Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli (see paper)
30% identity, 91% coverage: 9:339/362 of query aligns to 1:328/346 of 4a2cA
- active site: C38 (= C46), G39 (= G47), S40 (= S48), P43 (≠ H51), H59 (= H79), E60 (= E80), C89 (= C109), C92 (= C112), C95 (= C115), C103 (= C123), D107 (≠ A127), P145 (= P165), G149 (= G169)
- binding zinc ion: C89 (= C109), C92 (= C112), C95 (= C115), C103 (= C123)
Sites not aligning to the query:
Q96V44 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Hypocrea jecorina (Trichoderma reesei) (see paper)
30% identity, 97% coverage: 7:357/362 of query aligns to 27:373/377 of Q96V44
- DI 224:225 (≠ EM 212:213) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-362.
- A362 (≠ V346) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 224-SR-225.
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
30% identity, 90% coverage: 13:339/362 of query aligns to 7:338/357 of 7y9pA
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
28% identity, 92% coverage: 7:339/362 of query aligns to 2:318/337 of 4ilkA
- active site: C40 (= C46), G41 (= G47), S42 (= S48), H45 (= H51), H59 (= H79), E60 (= E80), C89 (= C109), C92 (= C112), C95 (= C115), C103 (= C123), A107 (= A127), P145 (= P165), A149 (≠ G169)
- binding manganese (ii) ion: C40 (= C46), H59 (= H79), E60 (= E80), E144 (= E164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G188), G170 (= G190), P171 (≠ T191), I172 (= I192), D193 (≠ E212), R194 (≠ M213), R198 (= R217), N213 (≠ P232), A235 (≠ C256), A236 (≠ I257), C237 (≠ G258), I241 (≠ T262), M258 (≠ V279), F260 (≠ I281)
- binding zinc ion: C89 (= C109), C92 (= C112), C95 (= C115), C103 (= C123)
Sites not aligning to the query:
Query Sequence
>PP_0552 FitnessBrowser__Putida:PP_0552
MNDLSHTHMRAAVWHGRHDIRVEQVPLPADPAPGWVQIKVDWCGICGSDLHEYVAGPVFI
PVEAPHPLTGIQGQCILGHEFCGHIAKLGEGVEGYAVGDPVAADACQHCGTCYYCTHGLY
NICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAGALIEPLAVGMHAVKKAGSLL
GQTVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARKAKAKEAGANVVLDPSQCDALAE
IRALTAGLGADVSFECIGNKHTAKLAIDTIRKAGKCVLVGIFEEPSEFNFFELVSTEKQV
LGALAYNGEFADVIAFIADGRLDIRPLVTGRIGLEQIVELGFEELVNNKEENVKIIVSPG
VR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory