SitesBLAST
Comparing PP_0654 FitnessBrowser__Putida:PP_0654 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P49814 Malate dehydrogenase; Vegetative protein 69; VEG69; EC 1.1.1.37 from Bacillus subtilis (strain 168) (see 2 papers)
45% identity, 96% coverage: 4:300/310 of query aligns to 7:304/312 of P49814
- S149 (≠ A145) modified: Phosphoserine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P80040 Malate dehydrogenase; EC 1.1.1.37 from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) (see 2 papers)
44% identity, 100% coverage: 1:310/310 of query aligns to 1:309/309 of P80040
1uxgA Large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface. (see paper)
44% identity, 99% coverage: 4:310/310 of query aligns to 3:308/308 of 1uxgA
- active site: R87 (= R89), D147 (= D149), R150 (= R152), H174 (= H176)
- binding fumaric acid: R81 (= R83), R87 (= R89), L146 (= L148), R150 (= R152), H174 (= H176), G212 (= G214), S223 (= S225)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (≠ L12), V12 (= V13), D32 (= D34), T76 (= T78), S77 (≠ A79), G78 (= G80), A79 (≠ V81), P80 (= P82), C101 (≠ I103), V117 (= V119), N119 (= N121), Q142 (= Q144), H174 (= H176), P228 (= P230)
7byaA Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and adenosine 5'- diphosphoribose (apr) (see paper)
43% identity, 96% coverage: 3:300/310 of query aligns to 5:303/311 of 7byaA
7by9A Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and nicotinamide adenine dinucleotide (NAD) (see paper)
43% identity, 96% coverage: 3:300/310 of query aligns to 5:303/311 of 7by9A
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), G13 (= G11), F14 (≠ L12), T15 (≠ V13), D35 (= D34), I36 (≠ V35), T81 (= T78), A82 (= A79), I102 (= I99), Q105 (≠ S102), V106 (≠ I103), L122 (≠ V119), N124 (= N121), V126 (= V123)
- binding oxaloacetate ion: L151 (= L148), R155 (= R152), H179 (= H176), G217 (= G214)
4plyA Crystal structure of ancestral apicomplexan malate dehydrogenase with malate. (see paper)
44% identity, 98% coverage: 4:306/310 of query aligns to 4:314/318 of 4plyA
- active site: D153 (= D149), R156 (= R152), H180 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G11), N12 (≠ L12), I13 (≠ V13), D33 (= D34), I34 (≠ V35), Y65 (≠ A66), T77 (= T78), A78 (= A79), G79 (= G80), I80 (≠ V81), P81 (= P82), I103 (= I99), V123 (= V119), N125 (= N121), M148 (≠ Q144), L152 (= L148), H180 (= H176), P239 (= P230)
- binding pyruvic acid: W91 (vs. gap), R93 (= R89), N125 (= N121), R156 (= R152), H180 (= H176), G223 (= G214)
4pltB Crystal structure of ancestral apicomplexan malate dehydrogenase with oxamate. (see paper)
44% identity, 98% coverage: 4:306/310 of query aligns to 5:315/319 of 4pltB
- active site: R94 (= R89), D154 (= D149), R157 (= R152), H181 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G12 (= G11), N13 (≠ L12), I14 (≠ V13), F33 (≠ M33), D34 (= D34), I35 (≠ V35), T78 (= T78), A79 (= A79), G80 (= G80), I81 (≠ V81), P82 (= P82), I104 (= I99), V124 (= V119), N126 (= N121), M149 (≠ Q144), H181 (= H176), P240 (= P230)
7f8dA Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) g218y mutant (see paper)
42% identity, 96% coverage: 3:300/310 of query aligns to 7:305/313 of 7f8dA
- binding nicotinamide-adenine-dinucleotide: G15 (= G11), F16 (≠ L12), T17 (≠ V13), D37 (= D34), I38 (≠ V35), L41 (vs. gap), Y71 (≠ A66), T83 (= T78), A84 (= A79), G85 (= G80), L124 (≠ V119), T125 (≠ S120), N126 (= N121), Q149 (= Q144), L153 (= L148), P235 (= P230)
3gvhA Crystal structure of lactate/malate dehydrogenase from brucella melitensis
42% identity, 96% coverage: 3:301/310 of query aligns to 3:305/318 of 3gvhA
- active site: R88 (= R89), D148 (= D149), R151 (= R152), H175 (= H176)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), I13 (≠ V13), D33 (= D34), I34 (≠ V35), T77 (= T78), A78 (= A79), I118 (≠ V119), N120 (= N121), M143 (≠ Q144), L147 (= L148), H175 (= H176)
P80039 Malate dehydrogenase; EC 1.1.1.37 from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) (see paper)
42% identity, 99% coverage: 4:309/310 of query aligns to 2:307/310 of P80039
1guzA Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases (see paper)
43% identity, 96% coverage: 4:300/310 of query aligns to 2:298/305 of 1guzA
- active site: D147 (= D149), R150 (= R152), H174 (= H176)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), N10 (≠ L12), V11 (= V13), D32 (= D34), V33 (= V35), T76 (= T78), G78 (= G80), L79 (≠ V81), P80 (= P82), I97 (= I99), V117 (= V119), N119 (= N121), M142 (≠ Q144), L146 (= L148), H174 (= H176), P228 (= P230)
4rosA Crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose
42% identity, 96% coverage: 3:300/310 of query aligns to 3:304/318 of 4rosA
- active site: R88 (= R89), D148 (= D149), R151 (= R152), H175 (= H176)
- binding adenosine-5-diphosphoribose: G11 (= G11), Q12 (≠ L12), I13 (≠ V13), D33 (= D34), I34 (≠ V35), T77 (= T78), A78 (= A79), G79 (= G80), V80 (= V81), P81 (= P82), V98 (≠ I99), T119 (≠ S120), N120 (= N121)
- binding oxaloacetate ion: R82 (= R83), R88 (= R89), N120 (= N121), L147 (= L148), R151 (= R152), H175 (= H176), G218 (= G214)
5ujkA Malate dehydrogenase from methylobacterium extorquens, complexed with NAD (see paper)
42% identity, 96% coverage: 3:300/310 of query aligns to 3:304/315 of 5ujkA
- active site: R88 (= R89), D148 (= D149), R151 (= R152), H175 (= H176)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), Q12 (≠ L12), I13 (≠ V13), D33 (= D34), I34 (≠ V35), T77 (= T78), A78 (= A79), G79 (= G80), V98 (≠ I99), I118 (≠ V119), N120 (= N121), M143 (≠ Q144), L147 (= L148), H175 (= H176)
1gv0A Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases (see paper)
42% identity, 96% coverage: 4:300/310 of query aligns to 2:294/301 of 1gv0A
- active site: D143 (= D149), R146 (= R152), H170 (= H176)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), N10 (≠ L12), V11 (= V13), D32 (= D34), V33 (= V35), T76 (= T78), A77 (= A79), G78 (= G80), L79 (≠ V81), P80 (= P82), V113 (= V119), N115 (= N121), M138 (≠ Q144), P224 (= P230)
3gviA Crystal structure of lactate/malate dehydrogenase from brucella melitensis in complex with adp
40% identity, 96% coverage: 3:301/310 of query aligns to 3:300/314 of 3gviA
4plfB Crystal structure of ancestral apicomplexan lactate dehydrogenase with lactate. (see paper)
39% identity, 99% coverage: 4:310/310 of query aligns to 6:321/330 of 4plfB
- active site: R95 (= R89), D155 (= D149), R158 (= R152), H182 (= H176)
- binding nicotinamide-adenine-dinucleotide: G13 (= G11), M14 (≠ L12), I15 (≠ V13), F34 (≠ M33), D35 (= D34), V36 (= V35), T79 (= T78), A80 (= A79), G81 (= G80), L82 (≠ V81), T83 (≠ P82), I105 (= I99), I125 (≠ V119), N127 (= N121), M150 (≠ Q144), H182 (= H176), P241 (= P230)
- binding pyruvic acid: W93 (vs. gap), R95 (= R89), N127 (= N121), R158 (= R152), H182 (= H176)
4plcA Crystal structure of ancestral apicomplexan lactate dehydrogenase with malate. (see paper)
39% identity, 99% coverage: 4:310/310 of query aligns to 6:321/324 of 4plcA
- active site: R95 (= R89), D155 (= D149), R158 (= R152), H182 (= H176)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G11), M14 (≠ L12), I15 (≠ V13), D35 (= D34), V36 (= V35), T79 (= T78), A80 (= A79), G81 (= G80), L82 (≠ V81), T83 (≠ P82), I125 (≠ V119), N127 (= N121), M150 (≠ Q144), H182 (= H176), P241 (= P230)
- binding pyruvic acid: W93 (vs. gap), R95 (= R89), N127 (= N121), R158 (= R152), H182 (= H176), G225 (= G214)
6vdjA Crystal structure of ancestral apicomplexan lactate dehydrogenase with sulfate and nadh4.
39% identity, 99% coverage: 4:310/310 of query aligns to 4:307/308 of 6vdjA
- binding 1,4,5,6-tetrahydronicotinamide adenine dinucleotide: G11 (= G11), M12 (≠ L12), I13 (≠ V13), D33 (= D34), V34 (= V35), A78 (= A79), I91 (= I99), I111 (≠ V119), T112 (≠ S120), N113 (= N121), M136 (≠ Q144), H168 (= H176)
1sowA T. Gondii bradyzoite-specific ldh (ldh2) in complex with NAD and oxalate
37% identity, 99% coverage: 3:310/310 of query aligns to 6:322/322 of 1sowA
- active site: R96 (= R89), D156 (= D149), R159 (= R152), H183 (= H176)
- binding nicotinamide-adenine-dinucleotide: G14 (= G11), M15 (≠ L12), I16 (≠ V13), D36 (= D34), V37 (= V35), T80 (= T78), A81 (= A79), G82 (= G80), L83 (≠ V81), T84 (≠ P82), I106 (= I99), E109 (≠ S102), V126 (= V119), T127 (≠ S120), N128 (= N121), M151 (≠ Q144), L155 (= L148), H183 (= H176), P242 (= P230)
- binding oxalate ion: W94 (vs. gap), R96 (= R89), R159 (= R152), H183 (= H176), G226 (= G214)
3czmB T. Gondii bradyzoite-specific ldh (ldh2) in complex with NAD and oxq
37% identity, 99% coverage: 3:310/310 of query aligns to 7:323/323 of 3czmB
- active site: R97 (= R89), D157 (= D149), R160 (= R152), H184 (= H176)
- binding nicotinamide-adenine-dinucleotide: G15 (= G11), M16 (≠ L12), I17 (≠ V13), D37 (= D34), V38 (= V35), T81 (= T78), A82 (= A79), G83 (= G80), L84 (≠ V81), T85 (≠ P82), I107 (= I99), V127 (= V119), N129 (= N121), M152 (≠ Q144), H184 (= H176)
- binding 4-hydroxy-1,2,5-oxadiazole-3-carboxylic acid: W95 (vs. gap), R97 (= R89), N129 (= N121), R160 (= R152), H184 (= H176), G227 (= G214), S238 (= S225)
Query Sequence
>PP_0654 FitnessBrowser__Putida:PP_0654
MVNKLTIVGAGLVGEAAAQIIARDELCRELVLMDVQGELAQGKALDVWQAAVDSGSDTHV
HGGAKAEMLEGSELVVITAGVPRKPGQSRQDVLSTNLPILDSIMADIKHHAPTATVLVVS
NPVDVLTYRAWSVSGQGRDKVFGQAGVLDTARMKCFIAEQTGFSARDITALVLGGHGDSM
VPLMRYCQIGSVPLSHFLSSEQIEQIVERTRKGGGEILGLKKTGSACDAPGVAIAQMVDA
IANGRNRILPAVAILEGEYGRTDIAMGVPCVLAEKGLARIIELPLDAQEQAMFDHSADQV
ARDIAEMKAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory