Comparing PP_0662 FitnessBrowser__Putida:PP_0662 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
37% identity, 92% coverage: 1:425/462 of query aligns to 2:433/464 of 4f4fA
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 85% coverage: 1:393/462 of query aligns to 5:430/514 of Q42598
1kl7A Crystal structure of threonine synthase from yeast (see paper)
32% identity, 84% coverage: 3:392/462 of query aligns to 7:426/509 of 1kl7A
Sites not aligning to the query:
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
31% identity, 83% coverage: 3:387/462 of query aligns to 7:402/496 of 8g1yA
Sites not aligning to the query:
1vb3A Crystal structure of threonine synthase from escherichia coli
29% identity, 99% coverage: 1:459/462 of query aligns to 1:428/428 of 1vb3A
>PP_0662 FitnessBrowser__Putida:PP_0662
MQYTSTRGNETRVDFRTALLSGLADDGGLYVPTSVPVFSPQEIASWSWLPFDELAWRVMA
PFVGDTLDEPTLRSLVSDSYRGFRHRGIAPLQQLGHNEWILQLFHGPTRSSKDFAAQLQA
RFVRHFLGAECERVMLVGASNGDTAVAAIEALRHCPAAGLLALYPSAGTPADRAAVMRSA
ASDSVSCVAVDGSFDDCQSLVSALLRDWPCPGLIPVSFNSTNWVGVLAQIVFYFHAALQL
GGGIRPVGFSIPTASFAEIYAGFIAQKMGLPINQIIVSTNRNDALHRFIHCNRYSRGSTS
QTLSPVMDFSLFSNLERFVWELYDRDGGATRALMEHFEACGELSIGNRQWLHARMLFDSY
AVDDALIREEIVTLFHETGSAVDPHAATGVFAGRLHRRNIGAPIVTLGQFAPEKSAGLLA
ELGAWHGEVPAGAVGTAGDGPLLAPDDLAGVHALLTRLQAGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory