Comparing PP_0664 FitnessBrowser__Putida:PP_0664 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
5x9dA Crystal structure of homoserine dehydrogenase in complex with l- cysteine and NAD (see paper)
31% identity, 97% coverage: 5:341/347 of query aligns to 2:298/302 of 5x9dA
7f4cA The crystal structure of the immature holo-enzyme of homoserine dehydrogenase complexed with NADP and 1,4-butandiol from the hyperthermophilic archaeon sulfurisphaera tokodaii. (see paper)
31% identity, 97% coverage: 5:341/347 of query aligns to 2:296/300 of 7f4cA
4pg7A Crystal structure of s. Aureus homoserine dehydrogenase at ph7.5 (see paper)
33% identity, 98% coverage: 1:340/347 of query aligns to 2:306/402 of 4pg7A
Sites not aligning to the query:
Q5F8J4 NAD(+)-dependent homoserine dehydrogenase; NAD(+)-dependent HSD; NgHSD; EC 1.1.1.3 from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) (see paper)
38% identity, 65% coverage: 116:340/347 of query aligns to 92:316/435 of Q5F8J4
Sites not aligning to the query:
6dzsA Mycobacterial homoserine dehydrogenase thra in complex with NADP
39% identity, 73% coverage: 84:338/347 of query aligns to 64:319/431 of 6dzsA
Sites not aligning to the query:
6a0sA Homoserine dehydrogenase from thermus thermophilus hb8 complexed with hse and NADPH (see paper)
36% identity, 92% coverage: 1:319/347 of query aligns to 1:284/331 of 6a0sA
Sites not aligning to the query:
2ejwA Homoserine dehydrogenase from thermus thermophilus hb8
36% identity, 92% coverage: 1:319/347 of query aligns to 1:284/331 of 2ejwA
6a0tB Homoserine dehydrogenase k99a mutant from thermus thermophilus hb8 complexed with hse and NADP+ (see paper)
36% identity, 92% coverage: 1:319/347 of query aligns to 1:284/332 of 6a0tB
Sites not aligning to the query:
4xb2A Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with NADPH (see paper)
30% identity, 96% coverage: 6:338/347 of query aligns to 5:309/319 of 4xb2A
4xb1A Hyperthermophilic archaeal homoserine dehydrogenase in complex with NADPH (see paper)
30% identity, 96% coverage: 6:338/347 of query aligns to 5:309/319 of 4xb1A
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 98% coverage: 2:340/347 of query aligns to 556:908/916 of O81852
Sites not aligning to the query:
3ingA Crystal structure of homoserine dehydrogenase (np_394635.1) from thermoplasma acidophilum at 1.95 a resolution
27% identity, 97% coverage: 3:338/347 of query aligns to 2:314/319 of 3ingA
3jsaA Homoserine dehydrogenase from thermoplasma volcanium complexed with NAD
26% identity, 98% coverage: 1:340/347 of query aligns to 1:319/321 of 3jsaA
P31116 Homoserine dehydrogenase; HDH; EC 1.1.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 58% coverage: 112:312/347 of query aligns to 101:326/359 of P31116
Sites not aligning to the query:
1tveA Homoserine dehydrogenase in complex with 4-(4-hydroxy-3- isopropylphenylthio)-2-isopropylphenol (see paper)
24% identity, 58% coverage: 112:312/347 of query aligns to 100:325/358 of 1tveA
Sites not aligning to the query:
1q7gA Homoserine dehydrogenase in complex with suicide inhibitor complex NAD-5-hydroxy-4-oxonorvaline (see paper)
24% identity, 58% coverage: 112:312/347 of query aligns to 100:325/358 of 1q7gA
Sites not aligning to the query:
1ebuD Homoserine dehydrogenase complex with NAD analogue and l-homoserine (see paper)
24% identity, 58% coverage: 112:312/347 of query aligns to 100:325/358 of 1ebuD
Sites not aligning to the query:
1ebfA Homoserine dehydrogenase from s. Cerevisiae complex with NAD+ (see paper)
24% identity, 58% coverage: 112:312/347 of query aligns to 100:325/358 of 1ebfA
Sites not aligning to the query:
O94671 Probable homoserine dehydrogenase; HDH; EC 1.1.1.3 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 55% coverage: 122:312/347 of query aligns to 117:334/376 of O94671
>PP_0664 FitnessBrowser__Putida:PP_0664
MTEYKIALVGFGGVNRALAQLIAERNARWQHELGFGLKIVGVTDLFLGSVIDRDGLDAAV
LAALPAQKGALAHIPQGSAEAFNEAVIKQSGADIIAEATFTNPKDGEPAATFCRWALEAG
KHVVTTNKGPIALHAQALKALAKANNVSFEYEGAVMSGTPVLRMARQTLAGAGLVGFEGI
LNGTSNYVLTRMEEGLGFNEAVAQAQALGFAEADPTADVEGHDVRLKVVILANELLGACL
QVGDVACSGISAIDSAAIERARAAGERWKLIGSARREAGGSVRASVEAKLLPGHHPLAGI
LGATNALAFDTELLGAVTVSGPGAGRIETAFALLSDIVAIHTAGHSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory