SitesBLAST
Comparing PP_0808 FitnessBrowser__Putida:PP_0808 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
43% identity, 100% coverage: 1:391/392 of query aligns to 1:396/396 of 1gvhA
- binding flavin-adenine dinucleotide: S46 (≠ A46), Q48 (= Q48), N50 (≠ S50), Y188 (= Y191), R204 (= R205), Q205 (≠ N206), Y206 (= Y207), S207 (= S208), A220 (≠ S221), V221 (= V222), E224 (= E225), G227 (= G228), Q228 (≠ K229), V229 (= V230), S230 (= S231), V269 (= V269), T272 (= T272), E388 (= E383), F390 (= F385)
- binding protoporphyrin ix containing fe: F43 (= F43), Q53 (= Q53), A56 (= A56), L57 (= L57), A60 (≠ G60), I61 (≠ V61), I81 (= I81), K84 (= K84), H85 (= H85), I90 (= I90), Q94 (≠ H94), Y95 (= Y95), L127 (= L130), F131 (≠ L134), H393 (≠ A388)
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
43% identity, 100% coverage: 1:391/392 of query aligns to 1:396/396 of P24232
- Y29 (= Y29) mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; mutation to F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- Y95 (= Y95) active site, Charge relay system
- E135 (= E138) active site, Charge relay system
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
44% identity, 99% coverage: 1:387/392 of query aligns to 1:398/403 of 3ozwA
- binding flavin-adenine dinucleotide: A46 (= A46), Q50 (≠ S50), R206 (= R205), Q207 (≠ N206), Y208 (= Y207), S209 (= S208), S222 (= S221), V223 (= V222), K224 (= K223), E226 (= E225), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (= V230), S237 (= S231), V276 (= V269), T279 (= T272), V395 (≠ F384), F396 (= F385)
- binding protoporphyrin ix containing fe: V42 (≠ L42), F43 (= F43), I81 (= I81), H85 (= H85), L88 (= L88), V90 (≠ I90), Q94 (≠ H94), Y95 (= Y95), V98 (= V98), Y126 (= Y127), A130 (= A131), L133 (= L134)
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: Q53 (= Q53), A56 (= A56), L102 (= L102), P398 (= P387)
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
44% identity, 99% coverage: 1:387/392 of query aligns to 1:398/403 of 3ozvA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: I24 (≠ L24), F28 (= F28), L57 (= L57), L102 (= L102), I106 (= I106)
- binding flavin-adenine dinucleotide: N44 (= N44), A46 (= A46), Q48 (= Q48), R206 (= R205), Q207 (≠ N206), Y208 (= Y207), S209 (= S208), S222 (= S221), V223 (= V222), K224 (= K223), E226 (= E225), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (= V230), S237 (= S231), V276 (= V269), T279 (= T272), F396 (= F385)
- binding protoporphyrin ix containing fe: F43 (= F43), I81 (= I81), K84 (= K84), H85 (= H85), L88 (= L88), V90 (≠ I90), Q94 (≠ H94), Y95 (= Y95), V98 (= V98), Y126 (= Y127), A130 (= A131), L133 (= L134)
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
44% identity, 99% coverage: 1:387/392 of query aligns to 1:398/403 of 3ozuA
- binding flavin-adenine dinucleotide: A46 (= A46), H47 (= H47), R206 (= R205), Q207 (≠ N206), Y208 (= Y207), S209 (= S208), S222 (= S221), V223 (= V222), K224 (= K223), E226 (= E225), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (= V230), S237 (= S231), E394 (= E383), V395 (≠ F384), G397 (= G386), P398 (= P387)
- binding protoporphyrin ix containing fe: F43 (= F43), N44 (= N44), I81 (= I81), H85 (= H85), L88 (= L88), V90 (≠ I90), Q94 (≠ H94), Y95 (= Y95), V98 (= V98), Y126 (= Y127), L129 (= L130), A130 (= A131), L133 (= L134)
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: I25 (≠ T25), F28 (= F28), F43 (= F43), A56 (= A56), L57 (= L57), L102 (= L102), W122 (= W123), A125 (= A126), Y126 (= Y127)
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
44% identity, 99% coverage: 1:387/392 of query aligns to 1:398/403 of P39662
- A60 (≠ G60) mutation to Y: Does not affect phospholipid-binding.
- V98 (= V98) mutation to F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
44% identity, 99% coverage: 1:387/392 of query aligns to 1:398/403 of 1cqxA
- binding flavin-adenine dinucleotide: A46 (= A46), H47 (= H47), Y190 (= Y191), R206 (= R205), Q207 (≠ N206), Y208 (= Y207), S209 (= S208), S222 (= S221), E226 (= E225), Q231 (vs. gap), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (= V230), S237 (= S231), V395 (≠ F384), G397 (= G386), P398 (= P387)
- binding protoporphyrin ix containing fe: F43 (= F43), N44 (= N44), I81 (= I81), H85 (= H85), L88 (= L88), V90 (≠ I90), Q94 (≠ H94), Y95 (= Y95), V98 (= V98), Y126 (= Y127), L129 (= L130), A130 (= A131), L133 (= L134)
4g1bA X-ray structure of yeast flavohemoglobin in complex with econazole (see paper)
40% identity, 99% coverage: 1:387/392 of query aligns to 1:392/398 of 4g1bA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: F28 (= F28), Y29 (= Y29), A56 (= A56), L57 (= L57), T60 (≠ G60), L102 (= L102), Y126 (= Y127)
- binding flavin-adenine dinucleotide: T46 (≠ A46), V50 (≠ S50), K84 (= K84), Y189 (= Y191), R207 (= R205), H208 (≠ N206), Y209 (= Y207), S210 (= S208), A223 (≠ S221), K225 (= K223), E227 (= E225), F233 (vs. gap), P234 (vs. gap), G236 (= G228), L237 (≠ K229), V238 (= V230), S239 (= S231), V282 (= V269), F390 (= F385)
- binding protoporphyrin ix containing fe: I42 (≠ L42), F43 (= F43), N44 (= N44), N47 (≠ H47), T60 (≠ G60), Q80 (= Q80), I81 (= I81), K84 (= K84), H85 (= H85), L88 (= L88), I90 (= I90), H94 (= H94), Y95 (= Y95), V98 (= V98), F133 (≠ L134), P392 (= P387)
Sites not aligning to the query:
Q03331 Flavohemoprotein; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Candida norvegensis (Yeast) (Candida mycoderma) (see paper)
33% identity, 99% coverage: 2:388/392 of query aligns to 13:386/390 of Q03331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
40% identity, 60% coverage: 153:387/392 of query aligns to 1:237/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (= Y191), R55 (= R205), Q56 (≠ N206), Y57 (= Y207), S58 (= S208), S71 (= S221), V72 (= V222), E75 (= E225), N81 (vs. gap), G83 (vs. gap), L84 (vs. gap), V85 (= V230), S86 (= S231), T127 (= T272), E233 (= E383), F235 (= F385)
6o0aA Crystal structure of flavohemoglobin from malassezia yamatoensis with bound fad and heme determined by iron sad phasing (see paper)
29% identity, 98% coverage: 2:386/392 of query aligns to 3:383/383 of 6o0aA
- binding flavin-adenine dinucleotide: S48 (≠ A46), R51 (≠ A49), D52 (≠ S50), Y190 (= Y191), R205 (= R205), Q206 (≠ N206), F207 (≠ Y207), T208 (≠ S208), K222 (= K223), D224 (≠ E225), H226 (≠ G227), G227 (= G228), E228 (≠ K229), M229 (≠ V230), T230 (≠ S231), T274 (= T272), E380 (= E383), F382 (= F385), G383 (= G386)
- binding protoporphyrin ix containing fe: M44 (≠ L42), F45 (= F43), S46 (≠ N44), L59 (= L57), S62 (≠ G60), R84 (≠ Q80), V85 (≠ I81), H89 (= H85), L92 (= L88), L94 (≠ I90), E98 (≠ H94), Y99 (= Y95), V102 (= V98), Y130 (= Y127), L133 (= L130)
2wy4A Structure of bacterial globin from campylobacter jejuni at 1.35 a resolution (see paper)
49% identity, 35% coverage: 5:142/392 of query aligns to 3:137/139 of 2wy4A
- binding protoporphyrin ix containing fe: M40 (≠ L42), F41 (= F43), N42 (= N44), Q51 (= Q53), L55 (= L57), A58 (≠ G60), V79 (≠ I81), T82 (≠ K84), H83 (= H85), L86 (= L88), V88 (≠ I90), H92 (= H94), Y93 (= Y95), V96 (= V98), Y129 (≠ L134)
3tm9A Y29a mutant of vitreoscilla stercoraria hemoglobin (see paper)
47% identity, 38% coverage: 1:147/392 of query aligns to 1:146/146 of 3tm9A
- binding protoporphyrin ix containing fe: L42 (= L42), F43 (= F43), Q53 (= Q53), L57 (= L57), T60 (≠ G60), I81 (= I81), K84 (= K84), H85 (= H85), V90 (≠ I90), Y95 (= Y95), V98 (= V98), Y126 (= Y127), F133 (≠ L134)
4vhbA Thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
46% identity, 38% coverage: 1:147/392 of query aligns to 1:138/138 of 4vhbA
- binding protoporphyrin ix containing fe: L42 (= L42), F43 (= F43), L49 (= L57), T52 (≠ G60), I73 (= I81), K76 (= K84), H77 (= H85), V82 (≠ I90), H86 (= H94), Y87 (= Y95), V90 (= V98), F125 (≠ L134)
- binding thiocyanate ion: F28 (= F28), L49 (= L57)
7dihA Crystal structure of thermoglobin y29f mutant in complex with imidazole
42% identity, 37% coverage: 1:144/392 of query aligns to 1:138/139 of 7dihA
- binding protoporphyrin ix containing fe: L42 (= L42), F43 (= F43), A46 (= A46), S47 (= S50), Q50 (= Q53), L54 (= L57), I78 (= I81), S81 (≠ K84), H82 (= H85), V87 (≠ I90), H91 (= H94), Y92 (= Y95), V95 (= V98), Y121 (= Y127), L124 (= L130)
3vhbA Imidazole adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
46% identity, 36% coverage: 2:144/392 of query aligns to 1:133/135 of 3vhbA
- binding protoporphyrin ix containing fe: F42 (= F43), L47 (= L57), T50 (≠ G60), I71 (= I81), K74 (= K84), H75 (= H85), V80 (≠ I90), H84 (= H94), Y85 (= Y95), V88 (= V98), Y116 (= Y127), F123 (≠ L134)
- binding imidazole: Y28 (= Y29), L47 (= L57)
6wk3D Engineered carbene transferase rmanod q52v, putative nitric oxide dioxygenase from rhodothermus marinus (see paper)
34% identity, 36% coverage: 2:142/392 of query aligns to 6:141/146 of 6wk3D
- binding copper (ii) ion: E51 (≠ H47), H55 (≠ G51)
- binding protoporphyrin ix containing fe: L46 (= L42), F47 (= F43), L57 (= L57), R80 (≠ Q80), M81 (≠ I81), S84 (≠ K84), H85 (= H85), R87 (≠ A87), A88 (≠ L88), V90 (≠ I90), H94 (= H94), Y95 (= Y95), V98 (= V98), Y126 (= Y127)
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
30% identity, 51% coverage: 178:378/392 of query aligns to 39:239/243 of 2eixA
- active site: H47 (≠ Y191), Y63 (= Y207), T64 (≠ S208), C217 (≠ L357)
- binding flavin-adenine dinucleotide: R61 (= R205), P62 (≠ N206), Y63 (= Y207), T64 (≠ S208), I78 (≠ S221), Y82 (≠ E225), K84 (≠ G227), G85 (= G228), M87 (≠ V230), S88 (= S231), T126 (≠ V269), T129 (= T272), F195 (≠ L336), M221 (≠ G361), A225 (= A365)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
27% identity, 58% coverage: 157:385/392 of query aligns to 109:334/337 of 1krhA
- active site: C306 (≠ L357)
- binding flavin-adenine dinucleotide: Y143 (= Y191), R155 (= R205), S156 (≠ N206), Y157 (= Y207), S158 (= S208), V171 (≠ S221), V172 (= V222), G178 (= G228), K179 (= K229), M180 (≠ V230), S181 (= S231), T219 (≠ V269), E332 (= E383), F334 (= F385)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 335, 336, 337
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 41, 43, 45, 46, 48, 82
Q9ZNT1 NADH--cytochrome b5 reductase 1; EC 1.6.2.2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 58% coverage: 156:382/392 of query aligns to 48:281/281 of Q9ZNT1
- L78 (≠ A186) mutation to F: In cbr1-1; decreased stability and decreased activity.
Sites not aligning to the query:
- 34:40 AKR2A-binding sequence (ABS) required for mitochondrion outer membrane targeting
Query Sequence
>PP_0808 FitnessBrowser__Putida:PP_0808
MLNAEQRAIIKATVPLLESGGEALTTHFYKMMLSEYPEVRPLFNQAHQASGDQPRALANG
VLMYARHIDQLEQLGGLVGQIINKHVALQILPEHYPIVGSCLLRAIEEVLGKDIATPAVI
DAWGAAYGQLADILIGAEENLYKEKEEAEGGWRGTREFRLVRREQESSEIVSFYFAPVDG
MPVLKAEPGQYIGLKLDIDGAEQRRNYSLSALCDGKEYRISVKREAGGKVSNYLHDELKV
GDTLQLFPPAGDFTLAASDKPLVLISGGVGITPTLAMLQAALQTRREVHFIHCARNGAVH
AFRDWIDGLAARHPQLKRFYCYAEPEGGAAADAVGLLSEDLLAEWLPQERDVDAYFLGPK
GFMAAVKRQLKGLGVPEQQSRYEFFGPAAALE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory