Comparing PP_0944 FitnessBrowser__Putida:PP_0944 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WN93 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
50% identity, 98% coverage: 3:450/459 of query aligns to 8:459/474 of P9WN93
4adlA Crystal structures of rv1098c in complex with malate (see paper)
50% identity, 97% coverage: 4:450/459 of query aligns to 1:451/459 of 4adlA
4apbD Crystal structure of mycobacterium tuberculosis fumarase (rv1098c) s318c in complex with fumarate (see paper)
50% identity, 97% coverage: 4:450/459 of query aligns to 1:451/462 of 4apbD
P05042 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Escherichia coli (strain K12) (see 4 papers)
46% identity, 99% coverage: 2:454/459 of query aligns to 1:459/467 of P05042
1fuqA Fumarase with bound 3-trimethylsilylsuccinic acid (see paper)
46% identity, 98% coverage: 6:454/459 of query aligns to 2:456/456 of 1fuqA
1fuoA FumarasE C with bound citrate (see paper)
46% identity, 98% coverage: 6:454/459 of query aligns to 2:456/456 of 1fuoA
1fupA Fumarase with bound pyromellitic acid (see paper)
46% identity, 98% coverage: 6:454/459 of query aligns to 1:455/455 of 1fupA
Q9ZCQ4 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Rickettsia prowazekii (strain Madrid E) (see paper)
44% identity, 99% coverage: 2:456/459 of query aligns to 1:461/461 of Q9ZCQ4
6s88A Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-((1,2,4,5-tetrahydro- 3h-benzo[d]azepin-3-yl)sulfonyl)phenyl)-2-(4-oxo-3,4- dihydrophthalazin-1-yl)acetamide (see paper)
49% identity, 97% coverage: 6:450/459 of query aligns to 2:442/450 of 6s88A
6s7wA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azepan-1-ylsulfonyl)-2- methoxyphenyl)-2-(quinolin-4-yl)acetamide (see paper)
49% identity, 97% coverage: 6:450/459 of query aligns to 2:442/450 of 6s7wA
6s7sA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-(n-phenylsulfamoyl) phenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
49% identity, 97% coverage: 6:450/459 of query aligns to 2:442/450 of 6s7sA
6s7uA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azepan-1-ylsulfonyl)-2- methoxyphenyl)-2-(1h-indol-3-yl)acetamide (see paper)
49% identity, 97% coverage: 6:450/459 of query aligns to 2:442/450 of 6s7uA
6s7kA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-(n-methylsulfamoyl) phenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
49% identity, 97% coverage: 6:450/459 of query aligns to 2:442/450 of 6s7kA
6s43A Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azocan-1-ylsulfonyl)-2- methoxyphenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
49% identity, 97% coverage: 6:450/459 of query aligns to 2:442/450 of 6s43A
7lubB Crystal structure of recombinant human fumarase in complex with d-2- amino-3-phosphono-propionic acid (see paper)
44% identity, 98% coverage: 6:454/459 of query aligns to 3:458/462 of 7lubB
P07954 Fumarate hydratase, mitochondrial; Fumarase; HsFH; EC 4.2.1.2 from Homo sapiens (Human) (see 4 papers)
44% identity, 98% coverage: 6:454/459 of query aligns to 51:506/510 of P07954
Sites not aligning to the query:
6s7zA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-((3,4-dihydroisoquinolin-2(1h)- yl)sulfonyl)-2-methoxyphenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl) acetamide (see paper)
48% identity, 97% coverage: 6:450/459 of query aligns to 2:441/449 of 6s7zA
P08417 Fumarate hydratase, mitochondrial; Fumarase; EC 4.2.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
43% identity, 99% coverage: 1:454/459 of query aligns to 24:484/488 of P08417
Sites not aligning to the query:
5f91A Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator (n-(5-(azepan-1-ylsulfonyl)-2- methoxyphenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide) (see paper)
48% identity, 97% coverage: 4:450/459 of query aligns to 1:439/447 of 5f91A
3r6vG Crystal structure of aspartase from bacillus sp. Ym55-1 with bound l- aspartate (see paper)
41% identity, 99% coverage: 4:459/459 of query aligns to 1:461/463 of 3r6vG
>PP_0944 FitnessBrowser__Putida:PP_0944
MMSDTRIERDSMGELQVPAQALYGAQTQRAVDNFPISGQRMPAQFIRALLLAKAAAAKAN
VELEQLSAGQGQAIVKAVEQLLAEDFIQHFPVDVFQTGSGTSSNMNANEVIATLATHVLG
EAVNANDHVNCGQSSNDIIPTTIHVSAALALHEQLLPALAHLVQVIEVKSAQVHQYVKTG
RTHLMDAMPVRMSQVLDGWAAQINAAKSHIEGVLPHLQALAQGGTAVGTGINAHPQFAVG
FARQLSGLTKVEFTPGQNLFALIGSQDTAVALSGQLKTTAVALMKIANDLRWMNSGPLAG
LGEIELQALQPGSSIMPGKVNPVIPEATAMVAAQVIGNDATIAVAGQAGNFELNVMLPVI
ARNLLESIELMANVSRLLADKAIASFKVNEDKLKEALARNPILVTALNPIIGYLKAAEIA
KTAYKQGRPIIDVALEHTDLSRDQLEALLDPEKLTAGGI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory