SitesBLAST
Comparing PP_0986 FitnessBrowser__Putida:PP_0986 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
46% identity, 99% coverage: 3:371/373 of query aligns to 31:400/403 of P48728
- D129 (= D101) mutation D->A,N: Loss of aminomethyltransferase activity.
- N145 (= N117) to I: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs386833682
- E232 (= E198) binding
- R261 (= R227) binding
- G269 (= G235) to D: in GCE2; decreased aminomethyltransferase activity; dbSNP:rs121964981
- R320 (= R290) to H: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs121964985
- Y399 (= Y370) binding
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
46% identity, 98% coverage: 5:371/373 of query aligns to 2:369/371 of 1wsvA
- active site: D98 (= D101)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (= M56), L85 (≠ Y88), D98 (= D101), L99 (= L102), I100 (≠ M103), V112 (= V115), N114 (= N117), F173 (= F171), G193 (= G190), Y194 (= Y191), E201 (= E198), R230 (= R227), L239 (= L236), Y368 (= Y370)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
37% identity, 98% coverage: 7:373/373 of query aligns to 3:358/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
37% identity, 98% coverage: 7:373/373 of query aligns to 3:358/362 of 1wopA
- active site: D96 (= D101)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (= M56), L55 (≠ I60), Y83 (= Y88), D96 (= D101), V98 (≠ M103), E106 (≠ T111), L108 (≠ F113), V110 (= V115), N112 (= N117), I137 (≠ L141), E160 (≠ P164), Y168 (≠ F171), Y169 (≠ M172), K173 (≠ R176), S174 (≠ V177), I175 (≠ K178), E180 (≠ D183), T181 (≠ C184), Y188 (= Y191), E195 (= E198), M197 (≠ S200), R227 (= R227), Y236 (≠ L236)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
37% identity, 98% coverage: 7:373/373 of query aligns to 3:358/362 of 1wooA
- active site: D96 (= D101)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (= M56), Y83 (= Y88), D96 (= D101), V98 (≠ M103), V110 (= V115), N112 (= N117), Y168 (≠ F171), Y169 (≠ M172), Y188 (= Y191), E195 (= E198), Y236 (≠ L236)
Sites not aligning to the query:
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
35% identity, 97% coverage: 7:366/373 of query aligns to 3:356/363 of 3a8iA
- active site: D97 (= D101)
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: M51 (= M56), Y84 (= Y88), D97 (= D101), I99 (≠ M103), V111 (= V115), N113 (= N117), F173 (≠ L179), Y188 (= Y191), E195 (= E198), R223 (= R227), M232 (≠ L236), W252 (= W256)
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
29% identity, 70% coverage: 8:268/373 of query aligns to 577:866/965 of 2gagA
Sites not aligning to the query:
- active site: 350, 375
- binding flavin mononucleotide: 510, 511, 517, 521, 549, 551
- binding nicotinamide-adenine-dinucleotide: 134, 135, 137, 138, 139, 158, 159, 160, 165, 166, 204, 205, 249, 250, 295, 381, 417, 418, 423, 424, 425, 554
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
27% identity, 70% coverage: 8:269/373 of query aligns to 576:857/963 of 3ad7A
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
27% identity, 70% coverage: 8:269/373 of query aligns to 576:857/963 of 1vrqA
- active site: D676 (= D101)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (≠ M56), Y663 (= Y88), G677 (≠ L102), H690 (≠ V115), I774 (≠ S189), F776 (≠ Y191), E783 (= E198), K822 (≠ A234), F824 (≠ L236)
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
27% identity, 70% coverage: 8:269/373 of query aligns to 577:858/965 of Q50LF0
Sites not aligning to the query:
- 139 binding
- 158 binding
- 159 binding
- 160 binding
- 166 binding
- 205 binding
- 418 binding
- 423 binding
- 425 binding
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
27% identity, 70% coverage: 8:269/373 of query aligns to 579:860/967 of Q46337
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 139 G→A: Does not affect activity and binding of NAD(+).
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
25% identity, 98% coverage: 8:372/373 of query aligns to 431:825/828 of 1pj6A
Sites not aligning to the query:
- active site: 223, 257
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 172, 201, 202, 204, 223, 257, 331, 332, 358, 359, 360, 361
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
25% identity, 98% coverage: 8:372/373 of query aligns to 430:824/827 of 1pj7A
- active site: D549 (= D101)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (≠ M56), Y536 (= Y88), D549 (= D101), T551 (≠ M103), G563 (≠ V115), F629 (≠ M172), Y648 (= Y191), E655 (= E198), Y696 (≠ L236)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 331, 357, 358, 359, 360
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
25% identity, 98% coverage: 8:372/373 of query aligns to 433:827/830 of Q9AGP8
- Y539 (= Y88) binding
- D552 (= D101) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 174 binding
- 225 Important for catalytic activity; H→Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
29% identity, 97% coverage: 7:369/373 of query aligns to 439:818/824 of Q8GAI3
Sites not aligning to the query:
- 66 mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- 67 H→A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
24% identity, 98% coverage: 8:372/373 of query aligns to 430:824/827 of 3gsiA
- active site: A549 (≠ D101)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (≠ M56), Y536 (= Y88), T551 (≠ M103), G563 (≠ V115), F629 (≠ M172), Y648 (= Y191), E655 (= E198), Y696 (≠ L236)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 89% coverage: 34:366/373 of query aligns to 510:841/857 of Q63342
Sites not aligning to the query:
- 52:53 binding
- 73:74 binding
- 80:88 binding
- 84 modified: Tele-8alpha-FAD histidine
- 212 binding
- 244 binding
- 390:395 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
25% identity, 89% coverage: 34:366/373 of query aligns to 473:804/824 of 4pabB
- active site: E536 (≠ D101)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ Y88), E536 (≠ D101), T538 (≠ M103), I550 (≠ V115), F612 (= F171), L613 (≠ M172), Y632 (= Y191), E639 (= E198), F680 (≠ L236), Y700 (≠ W256)
Sites not aligning to the query:
- active site: 53, 102, 226, 255
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 35, 36, 37, 43, 44, 45, 47, 48, 49, 50, 51, 175, 204, 205, 207, 226, 228, 326, 328, 353, 355, 356, 357, 358
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
24% identity, 89% coverage: 34:366/373 of query aligns to 517:848/866 of Q9UI17
- A530 (≠ G49) to G: in dbSNP:rs1805073
- S646 (≠ P164) to P: in dbSNP:rs1805074
Sites not aligning to the query:
- 59:60 binding
- 80:81 binding
- 87:95 binding
- 91 modified: Tele-8alpha-FAD histidine
- 109 H → R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- 219 binding
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
3tfjA Dmsp-dependent demethylase from p. Ubique - with cofactor thf (see paper)
20% identity, 87% coverage: 41:366/373 of query aligns to 48:369/369 of 3tfjA
- active site: D108 (= D101)
- binding (6s)-5,6,7,8-tetrahydrofolate: E63 (≠ M56), Y95 (= Y88), D108 (= D101), V110 (≠ M103), S122 (≠ V115), I123 (≠ V116), A124 (≠ K121), F178 (≠ M172), W197 (≠ Y191), E204 (= E198), Y265 (≠ A257)
Sites not aligning to the query:
Query Sequence
>PP_0986 FitnessBrowser__Putida:PP_0986
MSETLLKTPLHALHLELGARMVPFAGYDMPVQYPLGVLKEHLHTREQAGLFDVSHMGQII
LRGADAAKALESLVPVDIIDLPVGMQRYAMFTNEQGGILDDLMVANLGEDTLFLVVNAAC
KEQDLAHLQTHIGSRCEVQPLFEERALLALQGPAAVKVLERLAPEVAGMTFMQFRRVKLL
GVDCFVSRSGYTGEDGYEISVPVNAADALARRLMAEPEVQPIGLGARDSLRLEAGLCLYG
HDMNSETTPIEASLLWAISKVRRADGARAAGFPGAEAIFAHVRDGVARKRVGLLPQERTP
VREGADIVDANDKPVGKVCSGGFGPTLAAPVAMGYIDSEHAALDTALFAVVRGKKVALKV
SKMPFVTPRYYRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory