Comparing PP_1010 FitnessBrowser__Putida:PP_1010 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
6ovtA Crystal structure of ilvd from mycobacterium tuberculosis (see paper)
29% identity, 83% coverage: 67:572/608 of query aligns to 38:539/562 of 6ovtA
P9WKJ5 Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 83% coverage: 67:572/608 of query aligns to 51:552/575 of P9WKJ5
Q9LIR4 Dihydroxy-acid dehydratase, chloroplastic; AthDHAD; DAD; EC 4.2.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 90% coverage: 21:565/608 of query aligns to 54:574/608 of Q9LIR4
8hs0A The mutant structure of dhad v178w
30% identity, 85% coverage: 51:565/608 of query aligns to 37:536/570 of 8hs0A
8ej0A Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mg
32% identity, 83% coverage: 68:571/608 of query aligns to 38:530/568 of 8ej0A
8epzA Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn
32% identity, 83% coverage: 68:571/608 of query aligns to 39:531/569 of 8epzA
Q1JUQ1 L-arabonate dehydratase; L-arabinonate dehydratase; EC 4.2.1.25 from Azospirillum brasilense (see paper)
31% identity, 82% coverage: 68:565/608 of query aligns to 44:529/583 of Q1JUQ1
B5ZZ34 L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 from Rhizobium leguminosarum bv. trifolii (strain WSM2304) (see 2 papers)
30% identity, 82% coverage: 68:565/608 of query aligns to 47:531/579 of B5ZZ34
5j85A Ser480ala mutant of l-arabinonate dehydratase (see paper)
30% identity, 82% coverage: 68:565/608 of query aligns to 44:528/576 of 5j85A
7m3kA Crystal structure of galactonate dehydratase from brucella melitensis biovar abortus 2308
26% identity, 82% coverage: 68:565/608 of query aligns to 41:535/587 of 7m3kA
5oynA Crystal structure of d-xylonate dehydratase in holo-form (see paper)
29% identity, 70% coverage: 145:571/608 of query aligns to 117:548/589 of 5oynA
Sites not aligning to the query:
Q9A9Z2 D-xylonate dehydratase; XyDHT; Gluconate dehydratase; EC 4.2.1.82; EC 4.2.1.39 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see 2 papers)
29% identity, 70% coverage: 145:571/608 of query aligns to 123:554/595 of Q9A9Z2
Sites not aligning to the query:
>PP_1010 FitnessBrowser__Putida:PP_1010
MHPRILEVTQRLVERSRATRERYLQLIRGAASEGPMRASLQCANFAHGVAGCGSEDKQTL
RLMNAANVAIVSAYNDMLSAHQPYLHFPEQIKQALREVGSVGQFAGGVPAMCDGVTQGEP
GMELAIASREVIAMSTAVALSHNMFDAALMLGICDKIVPGLMMGALRFGHLPTIFVPGGP
MVSGISNKQKADVRQRYAEGKASREELLESEMNSYHSPGTCTFYGTANTNQLVMEVMGLH
LPGASFVNPYTPLRDALTAEAAQQVTRMTKASGSFMPLGEIVDEKALVNSIVALHATGGS
TNHTLHIPAIAQAAGIQLTWQDMADLSEVVPTLSHVYPNGKADINHFQAAGGMAFLIREL
LDAGLLHEDVNTVAGHGLRRYTQEPFLDNGKLVWREGPQHSLDESILRPVSRPFSAEGGL
RVMEGNLGRGVMKVSAVAPEHQVVEAPARVFQDQQSLADAFKAGELERDFVAVVRFQGPR
CNGMPELHKLTPFLGVLQDRGYKVALVTDGRMSGASGKIPAAIHVCPEAYDGGPLARVRD
GDIVRVDGVEGTLRIMVSAEELASRELPPAPQGNDLGCGRELFGFMRMAFSPAEQGASAF
TSALEHLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory