Comparing PP_1011 FitnessBrowser__Putida:PP_1011 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
40% identity, 100% coverage: 2:319/319 of query aligns to 2:318/320 of 1sz2B
6da0A Crystal structure of glucokinase (nfhk) from naegleria fowleri (see paper)
27% identity, 80% coverage: 8:262/319 of query aligns to 32:318/378 of 6da0A
Sites not aligning to the query:
8dtcA Crystal structure of glucokinase with bound glucose from acanthamoeba castellanii
27% identity, 80% coverage: 1:256/319 of query aligns to 23:313/374 of 8dtcA
>PP_1011 FitnessBrowser__Putida:PP_1011
MKHLLVGDIGGTNARFALWRDNQLHEVNVFATVDYTNPEQAIEAYLESQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRTAFCKTLQVERLLLINDFTAMALGMTRLREGEFREVC
PGQADPSRPALVIGPGTGLGVGSLLRLGEQLWKALPGEGGHVDLPVGNAREAAIHQQIHS
QIGHVSAEAVLSGGGLVRLYQAICALDGDTPRHKTPAHITDAALGGEPRALAVVEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFTGVPVWLVT
AEFSGLEGAGVALQQALDH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory