Comparing PP_1014 FitnessBrowser__Putida:PP_1014 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P32140 Sulfoquinovose isomerase; SQ isomerase; Sulfoquinovose-sulfofructose isomerase; SQ-SF isomerase; EC 5.3.1.31 from Escherichia coli (strain K12) (see paper)
43% identity, 96% coverage: 10:410/416 of query aligns to 2:404/413 of P32140
2zblA Functional annotation of salmonella enterica yihs-encoded protein (see paper)
43% identity, 97% coverage: 10:413/416 of query aligns to 2:407/416 of 2zblA
7ag4D Crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) (see paper)
43% identity, 97% coverage: 10:413/416 of query aligns to 14:419/425 of 7ag4D
3wkiA Crystal structure of cellobiose 2-epimerase in complex with cellobiitol (see paper)
27% identity, 79% coverage: 40:366/416 of query aligns to 40:364/407 of 3wkiA
Sites not aligning to the query:
3wkhA Crystal structure of cellobiose 2-epimerase in complex with epilactose (see paper)
27% identity, 79% coverage: 40:366/416 of query aligns to 40:364/410 of 3wkhA
Sites not aligning to the query:
3wkgA Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose (see paper)
27% identity, 79% coverage: 40:366/416 of query aligns to 40:364/410 of 3wkgA
Sites not aligning to the query:
8h1lB Crystal structure of glucose-2-epimerase in complex with d-glucitol from runella slithyformis runsl_4512 (see paper)
23% identity, 79% coverage: 39:366/416 of query aligns to 42:380/423 of 8h1lB
Sites not aligning to the query:
>PP_1014 FitnessBrowser__Putida:PP_1014
MTPLNLYVNSWLNAPAHTAWRLAEAQRLLAFAKAAKLPDGFGNLDANGQLAPGARAETIN
TARMTHCFALAHLQGIPGSLAYAEHGVAALRGAMQDATHGGWFAHPGGHDDSGKAAYLHA
FVALAASSAVVAGAVDANTLLADAIQVIEAHFWSEDEGALRETFSRAWQLPEQYRGANSN
MHATEAFLALADVTGNGLWLQRALRIAERIIHTHATANGYRVIEHFDVHWQPLPDYNLEH
PADPFRPYGTTPGHALEWARLLLHLEASLERAGLYAPQWLPDSARALFDTACQQAWNVDG
EPGFVYTLDWADRPVVHARLHWVHAEACAAAAALLQRTGEAHYEQWYRCCWGFIANHFID
PIGGSWHHELDAHNQPAGSLWPGKPDLYHAYQALLLPGLSLAPSLASNLAGNVTKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory