Comparing PP_1025 FitnessBrowser__Putida:PP_1025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
P9WQB3 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
52% identity, 97% coverage: 7:548/557 of query aligns to 42:642/644 of P9WQB3
Sites not aligning to the query:
3figB Crystal structure of leucine-bound leua from mycobacterium tuberculosis (see paper)
54% identity, 97% coverage: 7:548/557 of query aligns to 25:575/577 of 3figB
3hpzB Crystal structure of mycobacterium tuberculosis leua complexed with bromopyruvate
54% identity, 97% coverage: 7:548/557 of query aligns to 25:575/576 of 3hpzB
3hq1A Crystal structure of mycobacterium tuberculosis leua complexed with citrate and mn2+
54% identity, 97% coverage: 7:548/557 of query aligns to 25:572/573 of 3hq1A
1sr9A Crystal structure of leua from mycobacterium tuberculosis (see paper)
54% identity, 97% coverage: 7:548/557 of query aligns to 25:572/573 of 1sr9A
3hpsA Crystal structure of mycobacterium tuberculosis leua complexed with ketoisocaproate (kic)
53% identity, 97% coverage: 7:548/557 of query aligns to 25:574/575 of 3hpsA
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
27% identity, 93% coverage: 28:547/557 of query aligns to 2:501/517 of Q9JZG1
Sites not aligning to the query:
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
29% identity, 65% coverage: 40:402/557 of query aligns to 11:347/379 of 4ov4A
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
29% identity, 65% coverage: 40:402/557 of query aligns to 11:349/380 of 4ov9A
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 65% coverage: 40:399/557 of query aligns to 92:444/503 of Q9FN52
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
30% identity, 54% coverage: 30:329/557 of query aligns to 1:288/308 of 3rmjB
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
27% identity, 65% coverage: 38:399/557 of query aligns to 23:377/409 of 6e1jA
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 60% coverage: 38:370/557 of query aligns to 90:412/506 of Q9FG67
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
24% identity, 72% coverage: 36:434/557 of query aligns to 25:368/399 of 6ktqA
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
25% identity, 46% coverage: 38:294/557 of query aligns to 9:235/312 of 2ztjA
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
25% identity, 46% coverage: 38:294/557 of query aligns to 9:237/314 of 2zyfA
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
24% identity, 46% coverage: 38:294/557 of query aligns to 8:236/347 of 3a9iA
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
24% identity, 46% coverage: 38:294/557 of query aligns to 9:243/376 of O87198
>PP_1025 FitnessBrowser__Putida:PP_1025
MTMLKDPSKKYRAFPTIDLPDRTWPSKTITQAPIWCSSDLRDGNQSLIEPMDSEKKLRFW
KTLVQVGVKEIEASFPSASQTDFDFVRTLIEDGHIPDDTTIQVLTQAREDLIARTFESLR
GAKKAIVHLYNATSPSFRRIVFNQDKQGVKDIAVNAAKLFVKYAAQQPETQWTFQYSPET
FSATEMEFAKEVCDAVIEVWNPTPEHKIILNLPATVEVSTPNIYADQIEWFCRNVSRRDS
VIISLHCHNDRGTGIAATELGLMAGADRAEGCLFGNGERTGNVDLVTLALNLYTQGIDPL
LDFSDIDGVRKVVEECNQLPVHPRHPYVGDLVHTAFSGSHQDAIRKGFAKQQDGELWEVP
YLPIDPADIGRSYEAVIRVNSQSGKGGITYLLEQEYGISLPRRMQIEFSQVVQGETDRLG
LEMTAQQIYSLLHKEYLQANAPYALVSHRLQEENGHSAVEVEVAGEGETTLHWRGKGNGA
LEALVAGLPIAVEIMDYNEHAIGAGTNAKAAAYIELRVAGGRPVHGVGIDENITTASFKA
LFSALNRSLSQQEAKAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory