SitesBLAST – Find functional sites

 

SitesBLAST

Comparing PP_1073 FitnessBrowser__Putida:PP_1073 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 7 hits to proteins with known functional sites (download)

2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
56% identity, 91% coverage: 40:508/514 of query aligns to 27:496/501 of 2qcuB

query
sites
2qcuB
L
 
L
K
 
S
V
 
V
F
 
L
L
 
M
C
x
L
E
|
E
K
x
A
D
 
Q
D
 
D
L
 
L
A
 
A
Q
x
C
H
x
A
T
|
T
S
|
S
S
 
S
A
|
A
S
|
S
S
|
S
K
|
K
L
|
L
I
 
I
H
|
H
G
 
G
G
 
G
L
 
L
R
|
R
Y
|
Y
L
 
L
E
 
E
H
 
H
Y
 
Y
E
 
E
F
 
F
R
 
R
L
 
L
V
 
V
R
 
S
E
 
E
A
 
A
L
 
L
A
 
A
E
 
E
R
 
R
E
 
E
V
 
V
L
 
L
L
 
L
A
 
K
K
 
M
A
 
A
P
 
P
H
 
H
I
 
I
V
 
A
K
 
F
P
 
P
M
 
M
R
 
R
F
 
F
V
 
R
L
 
L
P
 
P
H
 
H
R
 
R
P
 
P
H
 
H
L
 
L
R
 
R
P
 
P
A
 
A
W
 
W
M
 
M
I
 
I
R
 
R
A
 
I
G
 
G
L
 
L
F
 
F
L
 
M
Y
 
Y
D
 
D
H
 
H
L
 
L
G
 
G
K
 
K
R
 
R
K
 
T
R
 
S
L
 
L
G
 
P
A
 
G
S
 
S
R
 
T
S
 
G
L
 
L
R
 
R
F
 
F
G
 
G
P
 
A
G
 
N
Y
 
S
P
 
V
L
 
L
K
 
K
P
 
P
A
 
E
I
 
I
T
 
K
R
 
R
G
 
G
F
 
F
E
 
E
Y
 
Y
A
 
S
D
 
D
C
 
C
A
 
W
V
 
V
D
 
D
D
 
D
A
 
A
R
 
R
L
 
L
V
 
V
V
 
L
L
 
A
N
 
N
A
 
A
M
 
Q
A
 
M
A
 
V
R
 
V
E
 
R
L
 
K
G
 
G
A
 
G
H
 
E
I
 
V
R
 
L
T
 
T
R
 
R
T
 
T
R
|
R
C
x
A
L
 
T
R
 
S
A
 
A
E
 
R
R
 
R
V
 
E
E
 
N
G
 
G
L
 
L
W
 
W
Q
 
I
V
 
V
E
 
E
L
 
A
Q
 
E
H
 
D
A
 
I
D
 
D
-
 
T
G
 
G
S
 
K
L
 
K
Q
 
Y
T
 
S
I
 
W
H
 
Q
A
 
A
R
 
R
A
 
G
L
 
L
V
 
V
N
 
N
A
|
A
A
x
T
G
|
G
P
|
P
W
|
W
V
 
V
A
 
K
S
 
Q
F
|
F
I
 
F
K
 
D
D
 
D
D
 
G
L
 
M
K
 
H
L
 
L
D
 
P
A
 
S
P
 
P
Y
 
Y
G
 
G
I
 
I
R
 
R
L
 
L
I
 
I
Q
 
K
G
|
G
S
 
S
H
|
H
I
 
I
I
 
V
V
 
V
P
 
P
R
 
R
L
 
V
Y
 
H
E
 
T
G
 
Q
E
 
K
H
 
Q
A
 
A
Y
 
Y
I
 
I
L
 
L
Q
 
Q
N
 
N
E
 
E
D
 
D
Q
 
K
R
 
R
I
 
I
V
 
V
F
 
F
C
 
V
I
 
I
P
 
P
Y
 
W
L
 
M
D
 
D
R
 
E
F
 
F
T
 
S
L
 
I
I
 
I
G
 
G
T
|
T
T
 
T
D
 
D
R
 
V
E
 
E
Y
 
Y
S
 
K
G
 
G
D
 
D
P
 
P
A
 
K
A
 
A
V
 
V
A
 
K
I
 
I
T
 
E
E
 
E
Q
 
S
E
 
E
T
 
I
H
 
N
Y
 
Y
L
 
L
L
 
L
K
 
N
V
 
V
V
 
Y
N
 
N
E
 
T
H
 
H
F
 
F
N
 
K
H
 
K
Q
 
Q
L
 
L
S
 
S
Q
 
R
A
 
D
D
 
D
I
 
I
L
 
V
H
 
W
T
 
T
Y
 
Y
S
 
S
G
|
G
V
|
V
R
|
R
P
 
P
L
 
L
C
 
C
N
 
D
D
 
D
E
 
E
S
 
S
D
 
D
N
 
S
P
 
P
S
 
Q
A
 
A
V
 
I
T
 
T
R
|
R
D
 
D
Y
 
Y
T
 
T
L
 
L
A
 
D
L
 
I
S
 
H
A
 
D
E
 
E
V
 
N
G
 
G
Q
 
K
A
 
A
P
 
P
L
 
L
L
 
L
S
 
S
V
 
V
F
 
F
G
 
G
G
|
G
K
|
K
L
|
L
T
|
T
T
 
T
Y
 
Y
R
 
R
K
 
K
L
 
L
A
 
A
E
 
E
S
 
H
A
 
A
M
 
L
A
 
E
E
 
K
L
 
L
K
 
T
P
 
P
F
 
Y
F
 
Y
T
 
Q
Q
 
G
M
 
I
R
 
G
A
 
P
P
 
A
W
 
W
T
 
T
A
 
K
S
 
E
A
 
S
P
 
V
L
 
L
P
 
P
G
 
G
A
 
G
E
 
A
G
 
I
M
 
E
T
 
G
T
 
D
V
 
R
Q
 
D
A
 
D
L
 
Y
I
 
A
D
 
A
A
 
R
V
 
L
L
 
R
A
 
R
R
 
R
C
 
Y
G
 
P
W
 
F
L
 
L
P
 
T
V
 
E
D
 
S
L
 
L
A
 
A
K
 
R
R
 
H
W
 
Y
V
 
A
L
 
R
T
 
T
Y
 
Y
G
 
G
S
 
S
R
 
N
V
 
S
W
 
E
R
 
L
L
 
L
L
 
L
D
 
G
G
 
N
V
 
A
H
 
G
G
 
T
P
 
V
E
 
S
D
 
D
L
 
L
G
 
G
Q
 
E
A
 
D
I
 
F
G
 
G
A
 
H
G
 
E
L
 
F
F
 
Y
T
 
E
R
 
A
E
 
E
V
 
L
D
 
K
Y
 
Y
L
 
L
L
 
V
E
 
D
E
 
H
E
 
E
W
 
W
A
 
V
E
 
R
Q
 
R
T
 
A
A
 
D
D
 
D
I
 
A
I
 
L
W
 
W
R
 
R
R
 
R
T
 
T
K
 
K
L
 
Q
G
 
G
L
 
M
S
 
W
L
 
L
T
 
N
A
 
A
Q
 
D
E
 
Q
Q
 
Q
M
 
S
A
 
R
L
 
V
E
 
S
A
 
Q
Y
 
W
L
 
L
Q
 
V
Q
 
E
A
 
Y
R
 
T
K
 
Q
V
 
Q
R
 
R

Sites not aligning to the query:

2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
57% identity, 90% coverage: 40:501/514 of query aligns to 27:489/495 of 2r46A

query
sites
2r46A
L
 
L
K
 
S
V
 
V
F
 
L
L
 
M
C
x
L
E
|
E
K
x
A
D
 
Q
D
 
D
L
 
L
A
 
A
Q
x
C
H
x
A
T
|
T
S
|
S
S
 
S
A
|
A
S
|
S
S
|
S
K
|
K
L
|
L
I
 
I
H
|
H
G
 
G
G
 
G
L
 
L
R
|
R
Y
|
Y
L
 
L
E
 
E
H
 
H
Y
 
Y
E
 
E
F
 
F
R
 
R
L
 
L
V
 
V
R
 
S
E
 
E
A
 
A
L
 
L
A
 
A
E
 
E
R
 
R
E
 
E
V
 
V
L
 
L
L
 
L
A
 
K
K
 
M
A
 
A
P
 
P
H
 
H
I
 
I
V
 
A
K
 
F
P
 
P
M
 
M
R
 
R
F
 
F
V
 
R
L
 
L
P
 
P
H
 
H
R
 
R
P
 
P
H
 
H
L
 
L
R
 
R
P
 
P
A
 
A
W
 
W
M
 
M
I
 
I
R
 
R
A
 
I
G
 
G
L
 
L
F
 
F
L
 
M
Y
 
Y
D
 
D
H
 
H
L
 
L
G
 
G
K
 
K
R
 
R
K
 
T
R
 
S
L
 
L
G
 
P
A
 
G
S
 
S
R
 
T
S
 
G
L
 
L
R
 
R
F
 
F
G
 
G
P
 
A
G
 
N
Y
 
S
P
 
V
L
 
L
K
 
K
P
 
P
A
 
E
I
 
I
T
 
K
R
 
R
G
 
G
F
 
F
E
 
E
Y
 
Y
A
 
S
D
 
D
C
 
C
A
 
W
V
 
V
D
 
D
D
 
D
A
 
A
R
 
R
L
 
L
V
 
V
V
 
L
L
 
A
N
 
N
A
 
A
M
x
Q
A
 
M
A
 
V
R
x
V
E
 
R
L
 
K
G
 
G
A
 
G
H
 
E
I
 
V
R
 
L
T
 
T
R
 
R
T
 
T
R
|
R
C
x
A
L
 
T
R
 
S
A
 
A
E
 
R
R
 
R
V
 
E
E
 
N
G
 
G
L
 
L
W
 
W
Q
 
I
V
 
V
E
 
E
L
 
A
Q
 
E
H
 
D
A
 
I
D
 
D
-
 
T
G
 
G
S
 
K
L
 
K
Q
 
Y
T
 
S
I
 
W
H
 
Q
A
 
A
R
 
R
A
 
G
L
 
L
V
 
V
N
 
N
A
|
A
A
x
T
G
|
G
P
|
P
W
|
W
V
 
V
A
 
K
S
 
Q
F
|
F
I
 
F
K
 
D
D
 
D
D
 
G
L
 
M
K
 
H
L
 
L
D
 
P
A
 
S
P
 
P
Y
 
Y
G
 
G
I
 
I
R
 
R
L
 
L
I
 
I
Q
 
K
G
|
G
S
 
S
H
|
H
I
 
I
I
 
V
V
 
V
P
 
P
R
 
R
L
 
V
Y
 
H
E
 
T
G
 
Q
E
 
K
H
 
Q
A
 
A
Y
 
Y
I
 
I
L
 
L
Q
 
Q
N
 
N
E
 
E
D
 
D
Q
 
K
R
|
R
I
|
I
V
 
V
F
|
F
C
 
V
I
 
I
P
 
P
Y
 
W
L
 
M
D
 
D
R
 
E
F
 
F
T
 
S
L
 
I
I
 
I
G
 
G
T
|
T
T
 
T
D
|
D
R
 
V
E
 
E
Y
 
Y
S
 
K
G
 
G
D
 
D
P
 
P
A
 
K
A
 
A
V
 
V
A
 
K
I
 
I
T
 
E
E
 
E
Q
 
S
E
 
E
T
 
I
H
 
N
Y
 
Y
L
 
L
L
 
L
K
 
N
V
 
V
V
 
Y
N
 
N
E
 
T
H
 
H
F
 
F
N
 
K
H
 
K
Q
 
Q
L
 
L
S
 
S
Q
 
R
A
 
D
D
 
D
I
 
I
L
 
V
H
 
W
T
 
T
Y
 
Y
S
 
S
G
|
G
V
|
V
R
|
R
P
 
P
L
 
L
C
 
C
N
 
D
D
 
D
E
 
E
S
 
S
D
 
D
N
 
S
P
 
P
S
 
Q
A
 
A
V
 
I
T
 
T
R
|
R
D
 
D
Y
 
Y
T
 
T
L
 
L
A
 
D
L
 
I
S
 
H
A
 
D
E
 
E
V
 
N
G
 
G
Q
 
K
A
 
A
P
 
P
L
 
L
L
 
L
S
 
S
V
 
V
F
 
F
G
 
G
G
|
G
K
|
K
L
|
L
T
|
T
T
 
T
Y
 
Y
R
 
R
K
 
K
L
 
L
A
 
A
E
 
E
S
 
H
A
 
A
M
 
L
A
 
E
E
 
K
L
 
L
K
 
T
P
 
P
F
 
Y
F
 
Y
T
 
Q
Q
 
G
M
 
I
R
 
G
A
 
P
P
 
A
W
 
W
T
 
T
A
 
K
S
 
E
A
 
S
P
 
V
L
 
L
P
 
P
G
 
G
A
 
G
E
 
A
G
 
I
M
 
E
T
 
G
T
 
D
V
 
R
Q
 
D
A
 
D
L
 
Y
I
 
A
D
 
A
A
 
R
V
 
L
L
 
R
A
 
R
R
 
R
C
 
Y
G
 
P
W
 
F
L
 
L
P
 
T
V
 
E
D
 
S
L
 
L
A
 
A
K
 
R
R
 
H
W
 
Y
V
 
A
L
 
R
T
 
T
Y
 
Y
G
 
G
S
 
S
R
 
N
V
 
S
W
 
E
R
 
L
L
 
L
L
 
L
D
 
G
G
 
N
V
 
A
H
 
G
G
 
T
P
 
V
E
 
S
D
 
D
L
 
L
G
 
G
Q
 
E
A
 
D
I
 
F
G
 
G
A
 
H
G
 
E
L
 
F
F
 
Y
T
 
E
R
 
A
E
 
E
V
 
L
D
 
K
Y
 
Y
L
 
L
L
x
V
E
x
D
E
x
H
E
|
E
W
|
W
A
 
V
E
 
R
Q
 
R
T
 
A
A
 
D
D
 
D
I
 
A
I
 
L
W
 
W
R
 
R
R
 
R
T
 
T
K
 
K
L
 
Q
G
 
G
L
 
M
S
 
W
L
 
L
T
 
N
A
 
A
Q
 
D
E
 
Q
Q
 
Q
M
 
S
A
 
R
L
 
V
E
 
S
A
 
Q
Y
 
W
L
 
L

Sites not aligning to the query:

2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
57% identity, 90% coverage: 40:501/514 of query aligns to 27:489/495 of 2r45A

query
sites
2r45A
L
 
L
K
 
S
V
 
V
F
 
L
L
 
M
C
x
L
E
|
E
K
x
A
D
 
Q
D
 
D
L
 
L
A
 
A
Q
x
C
H
x
A
T
|
T
S
|
S
S
 
S
A
|
A
S
|
S
S
|
S
K
|
K
L
|
L
I
 
I
H
|
H
G
 
G
G
 
G
L
 
L
R
|
R
Y
|
Y
L
 
L
E
 
E
H
 
H
Y
 
Y
E
 
E
F
 
F
R
 
R
L
 
L
V
 
V
R
 
S
E
 
E
A
 
A
L
 
L
A
 
A
E
 
E
R
 
R
E
 
E
V
 
V
L
 
L
L
 
L
A
 
K
K
 
M
A
 
A
P
 
P
H
 
H
I
 
I
V
 
A
K
 
F
P
 
P
M
 
M
R
 
R
F
 
F
V
 
R
L
 
L
P
 
P
H
 
H
R
 
R
P
 
P
H
 
H
L
 
L
R
 
R
P
 
P
A
 
A
W
 
W
M
 
M
I
 
I
R
 
R
A
 
I
G
 
G
L
 
L
F
 
F
L
 
M
Y
 
Y
D
 
D
H
 
H
L
 
L
G
 
G
K
 
K
R
 
R
K
 
T
R
 
S
L
 
L
G
 
P
A
 
G
S
 
S
R
 
T
S
 
G
L
 
L
R
 
R
F
 
F
G
 
G
P
 
A
G
 
N
Y
 
S
P
 
V
L
 
L
K
 
K
P
 
P
A
 
E
I
 
I
T
 
K
R
 
R
G
 
G
F
 
F
E
 
E
Y
 
Y
A
 
S
D
 
D
C
 
C
A
 
W
V
 
V
D
 
D
D
 
D
A
 
A
R
 
R
L
 
L
V
 
V
V
 
L
L
 
A
N
 
N
A
 
A
M
x
Q
A
 
M
A
 
V
R
x
V
E
 
R
L
 
K
G
 
G
A
 
G
H
 
E
I
 
V
R
 
L
T
 
T
R
 
R
T
 
T
R
|
R
C
x
A
L
 
T
R
 
S
A
 
A
E
 
R
R
 
R
V
 
E
E
 
N
G
 
G
L
 
L
W
 
W
Q
 
I
V
 
V
E
 
E
L
 
A
Q
 
E
H
 
D
A
 
I
D
 
D
-
 
T
G
 
G
S
 
K
L
 
K
Q
 
Y
T
 
S
I
 
W
H
 
Q
A
 
A
R
 
R
A
 
G
L
 
L
V
 
V
N
 
N
A
|
A
A
x
T
G
|
G
P
|
P
W
|
W
V
 
V
A
 
K
S
x
Q
F
|
F
I
 
F
K
 
D
D
 
D
D
 
G
L
 
M
K
 
H
L
 
L
D
 
P
A
 
S
P
 
P
Y
 
Y
G
 
G
I
 
I
R
 
R
L
|
L
I
 
I
Q
 
K
G
|
G
S
 
S
H
|
H
I
 
I
I
 
V
V
 
V
P
 
P
R
 
R
L
 
V
Y
 
H
E
 
T
G
 
Q
E
 
K
H
 
Q
A
 
A
Y
 
Y
I
 
I
L
 
L
Q
 
Q
N
 
N
E
 
E
D
 
D
Q
 
K
R
|
R
I
|
I
V
 
V
F
|
F
C
 
V
I
 
I
P
 
P
Y
 
W
L
 
M
D
 
D
R
 
E
F
 
F
T
 
S
L
 
I
I
 
I
G
|
G
T
|
T
T
 
T
D
|
D
R
 
V
E
 
E
Y
 
Y
S
 
K
G
|
G
D
 
D
P
|
P
A
 
K
A
 
A
V
 
V
A
 
K
I
 
I
T
 
E
E
 
E
Q
 
S
E
 
E
T
 
I
H
 
N
Y
 
Y
L
 
L
L
 
L
K
 
N
V
 
V
V
 
Y
N
 
N
E
 
T
H
 
H
F
 
F
N
 
K
H
 
K
Q
 
Q
L
 
L
S
 
S
Q
 
R
A
 
D
D
 
D
I
 
I
L
x
V
H
x
W
T
 
T
Y
 
Y
S
 
S
G
|
G
V
|
V
R
|
R
P
 
P
L
 
L
C
 
C
N
 
D
D
 
D
E
 
E
S
 
S
D
 
D
N
 
S
P
 
P
S
 
Q
A
 
A
V
 
I
T
 
T
R
|
R
D
 
D
Y
 
Y
T
 
T
L
 
L
A
 
D
L
 
I
S
 
H
A
 
D
E
 
E
V
 
N
G
 
G
Q
 
K
A
 
A
P
 
P
L
 
L
L
 
L
S
 
S
V
 
V
F
 
F
G
 
G
G
|
G
K
|
K
L
|
L
T
|
T
T
 
T
Y
 
Y
R
 
R
K
 
K
L
 
L
A
 
A
E
 
E
S
 
H
A
 
A
M
 
L
A
 
E
E
 
K
L
 
L
K
 
T
P
 
P
F
 
Y
F
 
Y
T
 
Q
Q
 
G
M
 
I
R
 
G
A
 
P
P
 
A
W
 
W
T
 
T
A
 
K
S
 
E
A
 
S
P
 
V
L
 
L
P
 
P
G
 
G
A
 
G
E
 
A
G
 
I
M
 
E
T
 
G
T
 
D
V
 
R
Q
 
D
A
 
D
L
x
Y
I
 
A
D
 
A
A
x
R
V
x
L
L
 
R
A
 
R
R
|
R
C
 
Y
G
 
P
W
 
F
L
 
L
P
 
T
V
 
E
D
 
S
L
 
L
A
 
A
K
 
R
R
 
H
W
 
Y
V
 
A
L
 
R
T
 
T
Y
 
Y
G
 
G
S
 
S
R
 
N
V
 
S
W
 
E
R
 
L
L
 
L
L
 
L
D
 
G
G
 
N
V
 
A
H
 
G
G
 
T
P
 
V
E
 
S
D
 
D
L
 
L
G
 
G
Q
 
E
A
 
D
I
 
F
G
 
G
A
 
H
G
 
E
L
 
F
F
 
Y
T
 
E
R
 
A
E
 
E
V
 
L
D
 
K
Y
 
Y
L
 
L
L
x
V
E
x
D
E
x
H
E
|
E
W
|
W
A
 
V
E
 
R
Q
 
R
T
 
A
A
 
D
D
 
D
I
 
A
I
 
L
W
|
W
R
 
R
R
 
R
T
 
T
K
 
K
L
 
Q
G
|
G
L
x
M
S
 
W
L
 
L
T
 
N
A
 
A
Q
 
D
E
 
Q
Q
 
Q
M
 
S
A
 
R
L
 
V
E
 
S
A
 
Q
Y
 
W
L
 
L

Sites not aligning to the query:

Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 94% coverage: 18:502/514 of query aligns to 75:588/629 of Q9SS48

query
sites
Q9SS48
D
 
D
L
 
V
A
 
L
V
 
V
I
 
I
G
 
G
G
 
G
G
 
G
I
 
A
N
 
T
G
 
G
V
x
S
G
 
G
I
 
V
A
 
A
A
 
L
D
 
D
A
 
A
A
 
V
G
 
T
R
 
R
G
 
G
L
 
L
K
 
R
V
 
V
F
 
G
L
 
L
C
 
V
E
 
E
K
 
R
D
 
E
D
 
D
L
 
F
A
 
S
Q
 
S
H
 
G
T
 
T
S
 
S
S
 
S
A
 
R
S
 
S
S
 
T
K
 
K
L
 
L
I
 
I
H
 
H
G
 
G
G
 
G
L
 
V
R
 
R
Y
 
Y
L
 
L
E
 
E
H
 
K
Y
 
A
E
 
V
F
 
F
-
 
N
-
 
L
-
 
D
-
 
Y
-
 
G
-
 
Q
-
 
L
R
 
K
L
 
L
V
 
V
R
 
F
E
 
H
A
 
A
L
 
L
A
 
E
E
 
E
R
 
R
E
 
K
V
 
Q
L
 
L
L
 
I
A
 
E
K
 
N
A
 
A
P
 
P
H
 
H
I
 
L
V
 
C
K
 
H
P
 
A
M
 
L
R
 
P
F
 
C
V
 
M
L
 
T
P
 
P
H
 
C
R
 
F
P
 
D
H
 
W
L
 
F
R
 
E
P
 
V
A
 
I
-
 
Y
-
 
F
W
 
W
M
 
M
I
 
-
R
 
-
A
 
-
G
 
G
L
 
L
F
 
K
L
 
M
Y
 
Y
D
 
D
H
 
L
L
 
V
G
 
A
K
 
G
R
 
P
K
 
R
R
 
L
L
 
L
G
 
H
A
 
L
S
 
S
R
 
R
S
 
Y
L
 
Y
R
 
S
F
 
A
G
 
K
P
 
E
G
 
S
Y
 
I
P
 
E
L
 
L
K
 
F
P
 
P
A
 
T
I
 
L
T
 
A
R
 
R
G
 
K
F
 
G
E
 
K
-
 
D
-
 
K
-
 
N
-
 
L
-
 
R
-
 
G
-
 
T
-
 
V
-
 
V
Y
 
Y
A
 
Y
D
 
D
C
 
G
A
 
Q
V
 
M
D
 
N
D
 
D
A
 
S
R
 
R
L
 
L
-
 
N
-
 
V
-
 
G
-
 
L
-
 
A
-
 
C
-
 
T
-
 
A
-
 
A
-
 
L
-
 
A
-
 
G
-
 
A
V
 
A
V
 
V
L
 
L
N
 
N
A
 
H
M
 
A
A
 
E
A
 
V
R
 
V
E
 
S
L
 
L
G
 
I
A
 
T
H
 
D
I
 
D
R
 
A
T
 
T
R
 
K
T
 
-
R
 
R
C
 
I
L
 
I
R
 
G
A
 
A
E
 
R
R
 
I
V
 
R
E
 
N
G
 
N
L
 
L
W
 
T
Q
 
G
V
 
Q
E
 
E
L
 
F
Q
 
N
H
 
S
A
 
-
D
 
-
G
 
-
S
 
-
L
 
-
Q
 
-
T
 
-
I
 
-
H
 
Y
A
 
A
R
 
K
A
 
V
L
 
V
V
 
V
N
 
N
A
 
A
A
 
A
G
 
G
P
 
P
W
 
F
V
 
C
A
 
D
S
 
S
F
 
-
I
 
I
K
 
R
D
 
K
D
 
M
L
 
I
K
 
D
L
 
E
D
 
D
A
 
T
P
 
K
Y
 
P
G
 
M
I
 
I
R
 
C
L
 
P
I
 
S
Q
 
S
G
 
G
S
 
V
H
 
H
I
 
I
I
 
V
V
 
L
P
 
P
R
 
D
L
 
Y
Y
 
Y
-
 
S
-
 
P
E
 
E
G
 
G
E
 
M
H
 
G
A
 
L
Y
 
I
I
 
V
L
 
P
Q
 
K
N
 
T
E
 
K
D
 
D
Q
 
G
R
 
R
I
 
V
V
 
V
F
 
F
C
 
M
I
 
L
P
 
P
Y
 
W
L
 
L
D
 
G
R
 
R
F
 
-
T
 
T
L
 
V
I
 
A
G
 
G
T
 
T
T
 
T
D
 
D
R
 
S
E
 
N
Y
 
T
S
 
S
G
 
-
D
 
-
P
 
-
A
 
-
A
 
-
V
 
-
A
 
-
I
 
I
T
 
T
-
 
S
-
 
L
-
 
P
-
 
E
-
 
P
-
 
H
E
 
E
Q
 
D
E
 
E
T
 
I
H
 
Q
Y
 
F
L
 
I
L
 
L
K
 
D
V
 
A
V
 
I
N
 
S
E
 
D
H
 
Y
F
 
L
N
 
N
H
 
I
Q
 
K
L
 
V
S
 
R
Q
 
R
A
 
T
D
 
D
I
 
V
L
 
L
H
 
S
T
 
A
Y
 
W
S
 
S
G
 
G
V
 
I
R
 
R
P
 
P
L
 
L
C
 
A
N
 
M
D
 
D
-
 
P
E
 
T
S
 
A
D
 
K
N
 
S
P
 
T
S
 
E
A
 
S
V
 
I
T
 
S
R
 
R
D
 
D
Y
 
H
T
 
V
L
 
V
A
 
-
L
 
-
S
 
-
A
 
-
E
 
-
V
 
F
G
 
E
Q
 
E
A
 
N
P
 
P
-
 
G
L
 
L
L
 
V
S
 
T
V
 
I
F
 
T
G
 
G
G
 
G
K
 
K
L
 
W
T
 
T
T
 
T
Y
 
Y
R
 
R
K
 
S
L
 
M
A
 
A
E
 
E
S
 
D
A
 
A
M
 
V
-
 
D
-
 
A
-
 
A
-
 
I
-
 
K
-
 
S
A
 
G
E
 
Q
L
 
L
K
 
K
P
 
P
-
 
T
-
 
N
-
 
E
F
 
C
F
 
V
T
 
T
Q
 
Q
M
 
K
-
 
L
-
 
Q
-
 
L
-
 
L
-
 
G
R
 
S
A
 
Y
P
 
G
W
 
W
T
 
E
A
 
P
S
 
S
A
 
S
P
 
F
L
 
T
P
 
T
G
 
L
A
 
A
E
 
Q
G
 
Q
M
 
Y
T
 
V
T
 
R
V
 
M
Q
 
K
A
 
K
L
 
T
I
 
Y
D
 
G
A
 
G
V
 
K
L
 
V
A
 
V
R
 
P
C
 
-
G
 
G
W
 
A
L
 
M
P
 
D
V
 
T
D
 
A
L
 
A
A
 
A
K
 
K
R
 
H
W
 
L
V
 
S
L
 
H
T
 
A
Y
 
Y
G
 
G
S
 
S
R
 
M
V
 
A
W
 
D
R
 
R
L
 
V
L
 
A
D
 
T
G
 
-
V
 
I
H
 
A
G
 
Q
P
 
E
E
 
E
D
 
G
L
 
L
G
 
G
Q
 
K
A
 
R
I
 
L
G
 
A
A
 
H
G
 
G
-
 
H
-
 
P
L
 
F
F
 
L
T
x
E
R
 
A
E
 
E
V
 
V
D
 
A
Y
 
Y
L
 
C
L
 
A
E
 
R
E
 
H
E
 
E
W
 
Y
A
 
C
E
 
E
Q
 
S
T
 
A
A
 
V
D
 
D
I
 
F
I
 
I
W
 
A
R
 
R
R
 
R
T
 
C
K
 
R
L
 
I
G
 
A
L
 
F
S
 
L
L
 
D
T
 
T
A
 
D
Q
 
A
E
 
A
Q
 
A
M
 
R
A
 
A
L
 
L
E
 
Q
A
 
R
Y
 
V
L
 
V
Q
 
E

2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha- glycerophosphate dehydrogenase (see paper)
31% identity, 66% coverage: 39:378/514 of query aligns to 39:386/530 of 2rgoB

query
sites
2rgoB
G
 
G
L
 
I
K
 
K
V
 
T
F
 
G
L
 
L
C
x
I
E
|
E
K
x
M
D
x
Q
D
 
D
L
 
F
A
 
A
Q
 
E
H
x
G
T
|
T
S
|
S
S
 
S
A
x
R
S
|
S
S
x
T
K
 
K
L
 
L
I
 
V
H
 
H
G
 
G
G
 
G
L
 
I
R
 
R
Y
 
Y
L
 
L
E
 
K
H
 
T
Y
 
F
E
 
D
F
 
V
R
 
E
L
 
V
V
 
V
R
 
A
E
 
D
A
 
T
L
 
V
A
 
G
E
 
E
R
 
R
E
 
A
V
 
V
L
 
V
L
 
Q
A
 
G
K
 
I
A
 
A
P
 
P
H
 
H
I
 
I
V
 
P
K
 
K
P
 
P
M
 
D
R
 
P
F
 
M
V
 
L
L
 
L
P
 
P
-
 
I
-
 
Y
H
 
E
R
 
D
P
 
E
H
 
T
L
 
T
R
 
F
P
 
N
A
 
M
W
 
F
M
 
S
I
 
V
R
 
K
A
 
V
G
 
A
L
 
M
F
 
D
L
 
L
Y
 
Y
D
 
D
H
 
K
L
 
L
G
 
A
-
 
N
-
 
V
-
 
T
-
 
G
-
 
T
-
 
K
-
 
Y
K
 
E
R
 
N
K
 
Y
R
 
T
L
 
L
G
 
T
A
 
P
S
 
E
R
 
E
S
 
V
L
 
L
R
 
E
F
 
R
G
 
E
P
 
P
G
 
-
Y
 
F
P
 
L
L
 
K
K
 
K
P
 
E
A
 
G
I
 
L
T
 
K
R
 
G
G
 
A
F
 
G
E
 
V
Y
 
Y
A
 
L
D
 
D
C
 
F
A
 
R
V
 
N
D
 
N
D
 
D
A
 
A
R
 
R
L
 
L
V
 
V
V
 
I
L
 
D
N
 
N
A
 
I
M
 
K
A
 
K
A
 
A
R
 
A
E
 
E
L
 
D
G
 
G
A
 
A
H
 
Y
I
 
L
R
 
V
T
 
S
R
 
K
T
 
M
R
x
K
C
x
A
-
 
V
-
 
G
-
 
F
L
 
L
R
 
Y
A
 
G
E
 
D
R
 
Q
V
 
I
E
 
V
G
 
G
L
 
V
W
 
K
Q
 
A
V
 
R
E
 
D
L
 
L
Q
 
L
H
 
T
A
 
D
D
 
E
G
 
-
S
 
-
L
 
V
Q
 
I
T
 
E
I
 
I
H
 
K
A
 
A
R
 
K
A
 
L
L
 
V
V
 
I
N
 
N
A
x
T
A
x
S
G
|
G
P
|
P
W
|
W
V
 
V
A
 
D
S
 
K
F
x
V
I
 
-
K
 
-
D
 
R
D
 
N
L
 
L
K
 
N
L
 
F
D
 
P
A
 
V
P
 
S
Y
 
P
G
 
K
I
 
M
R
 
R
L
 
P
I
 
T
Q
 
K
G
|
G
S
 
I
H
 
H
I
 
L
I
 
V
V
 
V
-
 
D
-
 
A
P
 
K
R
 
K
L
 
L
Y
 
P
E
 
V
G
 
P
E
 
Q
H
 
P
A
 
T
Y
 
Y
I
 
F
-
 
D
L
 
T
Q
 
G
N
 
K
E
 
Q
D
 
D
Q
 
G
R
 
R
I
 
M
V
 
V
F
 
F
C
 
A
I
 
I
P
 
P
Y
 
R
L
 
E
D
 
N
R
 
K
F
 
-
T
 
T
L
 
Y
I
 
F
G
 
G
T
 
T
T
 
T
D
 
D
R
 
T
E
 
D
Y
 
Y
S
 
Q
G
 
G
D
 
D
P
 
F
A
 
T
A
 
D
V
 
P
A
 
K
I
 
V
T
 
T
E
 
Q
Q
 
E
E
 
D
T
 
V
H
 
D
Y
 
Y
L
 
L
L
 
L
K
 
D
V
 
V
V
 
I
N
 
N
E
 
H
H
 
R
F
 
Y
-
 
P
N
 
E
H
 
A
Q
 
N
L
 
I
S
 
T
Q
 
L
A
 
A
D
 
D
I
 
I
L
 
E
H
 
A
T
 
S
Y
 
W
S
 
A
G
|
G
V
x
L
R
|
R
P
|
P
L
 
L
C
 
L
-
 
I
-
 
G
N
 
N
D
 
S
E
 
G
S
 
S
D
 
D
N
x
Y
P
 
N
S
 
G
A
 
G
V
 
I
T
 
S
R
 
R
D
 
G
Y
 
S
T
 
S
L
 
L
A
 
E
L
 
R
S
 
E
A
 
P
E
 
D
V
 
-
G
 
-
Q
 
-
A
 
-
P
 
G
L
 
L
L
 
L
S
 
T
V
 
L
F
 
S
G
 
G
G
 
G
K
|
K
L
x
I
T
|
T
T
 
D
Y
 
Y
R
 
R
K
 
K
L
 
M
A
 
A
E
 
E
S
 
G
A
 
A
M
 
L

Sites not aligning to the query:

2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha- glycerophosphate dehydrogenase (see paper)
30% identity, 66% coverage: 39:378/514 of query aligns to 41:394/557 of 2rgoA

query
sites
2rgoA
G
 
G
L
 
I
K
 
K
V
 
T
F
 
G
L
 
L
C
x
I
E
|
E
K
x
M
D
x
Q
D
 
D
L
 
F
A
 
A
Q
 
E
H
x
G
T
|
T
S
|
S
S
 
S
A
x
R
S
|
S
S
x
T
K
 
K
L
 
L
I
 
V
H
 
H
G
 
G
G
 
G
L
 
I
R
 
R
Y
 
Y
L
 
L
E
 
K
H
 
T
Y
 
F
E
 
D
F
 
V
R
 
E
L
 
V
V
 
V
R
 
A
E
 
D
A
 
T
L
 
V
A
 
G
E
 
E
R
 
R
E
 
A
V
 
V
L
 
V
L
 
Q
A
 
G
K
 
I
A
 
A
P
 
P
H
 
H
I
 
I
V
 
P
K
 
K
P
 
P
M
 
D
R
 
P
F
 
M
V
 
L
L
 
L
P
 
P
-
 
I
-
 
Y
-
 
E
-
 
D
H
 
E
R
 
G
P
 
A
H
 
T
L
 
T
R
 
F
P
 
N
A
 
M
W
 
F
M
 
S
I
 
V
R
 
K
A
 
V
G
 
A
L
 
M
F
 
D
L
 
L
Y
 
Y
D
 
D
H
 
K
L
 
L
G
 
A
-
 
N
-
 
V
-
 
T
-
 
G
-
 
T
-
 
K
-
 
Y
K
 
E
R
 
N
K
 
Y
R
 
T
L
 
L
G
 
T
A
 
P
S
 
E
R
 
E
S
 
V
L
 
L
R
 
E
F
 
R
G
 
E
P
 
P
G
 
-
Y
 
F
P
 
L
L
 
K
K
 
K
P
 
E
A
 
G
I
 
L
T
 
K
R
 
G
G
 
A
F
 
G
E
 
V
Y
 
Y
A
 
L
D
 
D
C
 
F
A
 
R
V
 
N
D
 
N
D
 
D
A
 
A
R
 
R
L
 
L
V
 
V
V
 
I
L
 
D
N
 
N
A
 
I
M
 
K
A
 
K
A
 
A
R
 
A
E
 
E
L
 
D
G
 
G
A
 
A
H
 
Y
I
 
L
R
 
V
T
 
S
R
 
K
T
x
M
R
x
K
C
x
A
L
 
V
-
 
G
-
 
F
-
 
L
-
 
Y
R
 
E
A
 
G
E
 
D
R
 
Q
V
 
I
E
 
V
G
 
G
L
 
V
W
 
K
Q
 
A
V
 
R
E
 
D
L
 
L
Q
 
L
H
 
T
A
 
D
D
 
E
G
 
-
S
 
-
L
 
V
Q
 
I
T
 
E
I
 
I
H
 
K
A
 
A
R
 
K
A
 
L
L
 
V
V
 
I
N
 
N
A
x
T
A
x
S
G
|
G
P
|
P
W
|
W
V
 
V
A
 
D
S
 
K
F
x
V
I
 
R
K
 
N
D
 
L
D
 
N
L
 
F
K
 
T
L
 
R
D
 
P
A
 
V
P
 
S
Y
 
P
G
 
K
I
 
M
R
 
R
L
 
P
I
 
T
Q
 
K
G
|
G
S
 
I
H
 
H
I
 
L
I
 
V
V
 
V
-
 
D
-
 
A
P
 
K
R
 
K
L
 
L
Y
 
P
E
 
V
G
 
P
E
 
Q
H
 
P
A
 
T
Y
 
Y
I
 
F
-
 
D
L
 
T
Q
 
G
N
 
K
E
 
Q
D
 
D
Q
 
G
R
 
R
I
 
M
V
 
V
F
 
F
C
 
A
I
 
I
P
 
P
Y
 
R
L
 
E
D
 
N
R
 
K
F
 
-
T
 
T
L
 
Y
I
 
F
G
 
G
T
 
T
T
 
T
D
 
D
R
 
T
E
 
D
Y
 
Y
S
 
Q
G
 
G
D
 
D
P
 
F
A
 
T
A
 
D
V
 
P
A
 
K
I
 
V
T
 
T
E
 
Q
Q
 
E
E
 
D
T
 
V
H
 
D
Y
 
Y
L
 
L
L
 
L
K
 
D
V
 
V
V
 
I
N
 
N
E
 
H
H
 
R
F
 
Y
-
 
P
N
 
E
H
 
A
Q
 
N
L
 
I
S
 
T
Q
 
L
A
 
A
D
 
D
I
 
I
L
 
E
H
 
A
T
 
S
Y
 
W
S
 
A
G
|
G
V
x
L
R
|
R
P
|
P
L
 
L
C
 
L
-
 
I
-
 
G
N
 
N
D
 
S
E
 
G
S
 
S
D
 
D
-
x
Y
N
|
N
P
 
G
S
 
G
A
 
T
V
 
I
T
 
S
R
 
R
D
 
G
Y
 
S
T
 
S
L
 
L
A
 
E
L
 
R
S
 
E
A
 
P
E
 
D
V
 
-
G
 
-
Q
 
-
A
 
-
P
 
G
L
 
L
L
 
L
S
 
T
V
 
L
F
 
S
G
 
G
G
 
G
K
|
K
L
x
I
T
|
T
T
 
D
Y
 
Y
R
 
R
K
 
K
L
 
M
A
 
A
E
 
E
S
 
G
A
 
A
M
 
L

Sites not aligning to the query:

3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
27% identity, 88% coverage: 34:483/514 of query aligns to 36:442/496 of 3da1A

query
sites
3da1A
D
 
D
A
 
A
A
 
Q
G
 
V
R
 
R
G
 
G
L
 
I
K
 
Q
V
 
T
F
 
G
L
 
L
C
x
V
E
|
E
K
x
M
D
x
N
D
 
D
L
 
F
A
 
A
Q
x
S
H
x
G
T
|
T
S
|
S
S
 
S
A
x
R
S
|
S
S
x
T
K
 
K
L
|
L
I
 
V
H
|
H
G
 
G
G
 
-
L
 
-
R
 
-
Y
 
-
L
 
-
E
 
-
H
 
-
Y
 
-
E
 
-
F
 
-
R
 
-
L
 
-
V
 
-
R
 
-
E
 
-
A
 
V
L
 
G
A
 
K
E
 
E
R
 
R
E
 
A
V
 
I
L
 
V
L
 
Y
A
 
E
K
 
N
A
 
A
P
 
P
H
 
H
I
 
V
V
 
T
K
 
T
P
 
P
M
 
E
R
 
W
F
 
M
V
 
L
L
 
L
P
 
P
H
 
-
R
 
-
P
 
-
H
 
-
L
 
-
R
 
-
P
 
-
A
 
-
W
 
-
M
 
-
I
 
-
R
 
-
A
 
-
G
 
-
L
 
I
F
 
F
L
 
K
Y
 
R
D
 
Y
H
 
M
L
 
L
G
 
N
K
 
E
R
 
K
K
 
Q
R
 
T
L
 
L
G
 
E
A
 
K
S
 
E
R
 
P
S
 
L
L
 
L
R
 
R
F
 
-
G
 
-
P
 
-
G
 
-
Y
 
-
P
 
-
L
 
-
K
 
K
P
 
E
A
 
N
I
 
L
T
 
K
R
 
G
G
 
G
F
 
G
E
 
I
Y
 
Y
A
 
V
D
 
E
C
 
Y
A
 
R
V
 
T
D
 
D
D
 
D
A
 
A
R
 
R
L
 
L
V
 
T
V
 
L
L
 
E
N
 
I
A
 
M
M
 
K
A
 
E
A
 
A
R
 
V
E
 
A
L
 
R
G
 
G
A
 
A
-
 
V
-
 
A
-
 
L
-
 
N
H
 
Y
I
x
M
R
x
K
T
x
V
R
 
E
T
 
S
R
 
F
C
 
I
L
 
Y
R
 
D
A
 
Q
E
 
G
R
 
K
V
 
V
E
 
V
G
 
G
L
 
V
W
 
-
Q
 
-
V
 
V
E
 
A
L
 
K
Q
 
D
H
 
R
A
 
L
D
 
T
G
 
D
S
 
T
L
 
T
Q
 
H
T
 
T
I
 
I
H
 
Y
A
 
A
R
 
K
A
 
K
L
 
V
V
 
V
N
 
N
A
|
A
A
|
A
G
|
G
P
|
P
W
|
W
V
 
V
A
 
D
S
 
T
F
x
L
I
 
R
K
 
E
D
 
K
D
 
D
L
 
R
K
 
S
L
 
K
D
 
H
A
 
G
P
 
K
Y
 
Y
G
 
-
I
 
L
R
 
K
L
 
L
I
 
S
Q
 
K
G
|
G
S
 
V
H
|
H
I
 
L
I
 
V
V
 
V
-
 
D
-
 
Q
P
 
S
R
 
R
L
 
F
Y
 
P
E
 
L
G
 
R
E
 
Q
H
 
A
A
 
V
Y
 
Y
I
 
F
L
 
D
Q
 
T
N
 
E
E
 
S
D
 
D
Q
 
G
R
 
R
I
 
M
V
 
I
F
 
F
C
 
A
I
 
I
P
 
P
Y
 
R
L
 
E
D
 
G
R
 
K
F
 
-
T
 
T
L
 
Y
I
 
I
G
 
G
T
|
T
T
 
T
D
 
D
R
 
T
E
 
F
Y
 
Y
S
 
D
G
 
K
D
 
D
P
 
I
A
 
A
A
 
S
V
 
P
A
 
R
I
 
M
T
 
T
E
 
V
Q
 
E
E
 
D
T
 
R
H
 
D
Y
 
Y
L
 
I
L
 
L
K
 
A
V
 
A
V
 
A
N
 
N
E
 
Y
H
 
M
F
 
F
-
 
P
N
 
S
H
 
L
Q
 
R
L
 
L
S
 
T
Q
 
A
A
 
D
D
 
D
I
 
V
L
 
E
H
 
S
T
 
S
Y
 
W
S
 
A
G
|
G
V
x
L
R
|
R
P
 
P
L
 
L
C
 
I
N
 
H
D
 
E
E
 
D
S
 
E
D
 
I
N
 
F
P
 
F
S
 
S
A
 
-
V
 
-
T
 
-
R
 
-
D
 
-
Y
 
-
T
 
-
L
 
-
A
 
-
L
 
-
S
 
-
A
 
-
E
 
-
V
 
-
G
 
-
Q
 
D
A
 
S
P
 
G
L
 
L
L
 
I
S
 
S
V
 
I
F
 
A
G
 
G
G
|
G
K
|
K
L
|
L
T
|
T
T
 
G
Y
 
Y
R
 
R
K
 
K
L
 
M
A
 
A
E
 
E
S
 
R
A
 
T
M
 
V
A
 
D
E
 
A
L
 
V
K
 
A
P
 
Q
F
 
G
F
 
L
T
 
N
Q
 
V
M
 
N
R
 
E
A
 
P
P
 
C
W
 
T
T
 
T
A
 
A
S
 
A
A
 
I
P
 
R
L
 
L
P
 
S
G
 
G
-
 
G
-
 
L
A
 
A
E
 
E
G
 
G
M
 
A
T
 
Q
T
 
G
V
 
F
Q
 
P
A
 
R
L
 
F
I
 
L
D
 
D
A
 
E
V
 
A
L
 
S
-
 
R
-
 
K
-
 
G
A
 
A
R
 
K
C
 
L
G
 
G
W
 
F
L
 
-
P
 
D
V
 
A
D
 
D
L
 
E
A
 
V
K
 
R
R
 
R
W
 
L
V
 
A
L
 
K
T
 
L
Y
 
Y
G
 
G
S
 
S
R
 
N
V
 
V
W
 
D
R
 
H
L
 
V
L
 
L
D
 
N
G
 
Y
V
 
A
H
 
Y
G
 
E
P
 
G
E
 
K
D
 
E
L
 
E
G
 
A
Q
 
E
A
 
H
I
 
Y
G
 
G
-
 
L
A
 
P
G
 
A
L
 
L
F
 
L
T
 
L
R
 
G
E
 
Q
V
 
L
D
 
Q
Y
 
Y
L
 
G
L
 
V
E
 
E
E
 
Q
E
 
E
W
 
M
A
 
V
E
 
A
Q
 
T
T
 
P
A
 
L
D
 
D
I
 
F
I
 
F
W
 
V
R
 
R
R
 
R
T
 
T

Sites not aligning to the query:

Query Sequence

>PP_1073 FitnessBrowser__Putida:PP_1073
MPVSQPVSSQPPTANCYDLAVIGGGINGVGIAADAAGRGLKVFLCEKDDLAQHTSSASSK
LIHGGLRYLEHYEFRLVREALAEREVLLAKAPHIVKPMRFVLPHRPHLRPAWMIRAGLFL
YDHLGKRKRLGASRSLRFGPGYPLKPAITRGFEYADCAVDDARLVVLNAMAARELGAHIR
TRTRCLRAERVEGLWQVELQHADGSLQTIHARALVNAAGPWVASFIKDDLKLDAPYGIRL
IQGSHIIVPRLYEGEHAYILQNEDQRIVFCIPYLDRFTLIGTTDREYSGDPAAVAITEQE
THYLLKVVNEHFNHQLSQADILHTYSGVRPLCNDESDNPSAVTRDYTLALSAEVGQAPLL
SVFGGKLTTYRKLAESAMAELKPFFTQMRAPWTASAPLPGAEGMTTVQALIDAVLARCGW
LPVDLAKRWVLTYGSRVWRLLDGVHGPEDLGQAIGAGLFTREVDYLLEEEWAEQTADIIW
RRTKLGLSLTAQEQMALEAYLQQARKVRANSRAA

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory