Comparing PP_1110 FitnessBrowser__Putida:PP_1110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
37% identity, 71% coverage: 51:216/234 of query aligns to 98:252/280 of 7bw9A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
33% identity, 84% coverage: 22:217/234 of query aligns to 48:231/244 of 8i06A
Sites not aligning to the query:
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
33% identity, 84% coverage: 22:217/234 of query aligns to 44:227/258 of 8i04A
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
33% identity, 84% coverage: 22:217/234 of query aligns to 47:230/246 of 8i09A
Sites not aligning to the query:
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
35% identity, 77% coverage: 38:217/234 of query aligns to 58:231/250 of 4hzdA
Sites not aligning to the query:
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
34% identity, 73% coverage: 52:222/234 of query aligns to 78:237/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
34% identity, 73% coverage: 52:222/234 of query aligns to 76:235/243 of 7ra4A
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
32% identity, 84% coverage: 22:217/234 of query aligns to 48:231/262 of 1t3dA
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
32% identity, 84% coverage: 22:217/234 of query aligns to 44:227/258 of 4h7oA
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
36% identity, 78% coverage: 43:224/234 of query aligns to 95:270/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
36% identity, 77% coverage: 43:222/234 of query aligns to 93:266/267 of 3q1xA
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
34% identity, 68% coverage: 59:218/234 of query aligns to 87:235/272 of 3gvdI
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
32% identity, 85% coverage: 22:220/234 of query aligns to 44:230/257 of 1ssqD
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
34% identity, 85% coverage: 19:217/234 of query aligns to 45:230/243 of 4n69A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
33% identity, 85% coverage: 19:217/234 of query aligns to 41:220/233 of 4n6bA
Sites not aligning to the query:
1sstA Serine acetyltransferase- complex with coa (see paper)
30% identity, 85% coverage: 22:220/234 of query aligns to 44:223/233 of 1sstA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 40% coverage: 124:217/234 of query aligns to 73:169/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
35% identity, 40% coverage: 124:217/234 of query aligns to 72:168/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
35% identity, 40% coverage: 124:217/234 of query aligns to 72:168/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
35% identity, 40% coverage: 124:217/234 of query aligns to 72:168/200 of 1krrA
Sites not aligning to the query:
>PP_1110 FitnessBrowser__Putida:PP_1110
MDMQSAVIARLPVPDELESFKVVKNLVTSALLECCSIVEFEALKETPIIETVTEQAHADL
QAFAMKDPAAGRDLVFIAKTYTSYSAVLHYRLAHWIYNNSAATYGAGGQCLAAMISRRGK
MLSGAEIHFRSRIGARFIIDHGMGTVIGETSTIGDDCYVLGGVTLGARGISDNPSSPRHP
TLGNRVQIGAFASVLGAIHVGDGAFIGPGCIVTKDVPAAARVQVKTSLQVVLES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory