Comparing PP_1113 FitnessBrowser__Putida:PP_1113 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6c2zA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the plp-aminoacrylate intermediate (see paper)
28% identity, 93% coverage: 1:278/300 of query aligns to 26:310/345 of 6c2zA
Sites not aligning to the query:
6c2qA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the plp-l-serine intermediate (see paper)
28% identity, 93% coverage: 1:278/300 of query aligns to 26:310/345 of 6c2qA
Sites not aligning to the query:
6c2hA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the catalytic core (see paper)
28% identity, 93% coverage: 1:278/300 of query aligns to 26:310/345 of 6c2hA
Sites not aligning to the query:
6c4pA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the pmp complex (see paper)
28% identity, 93% coverage: 1:278/300 of query aligns to 25:309/344 of 6c4pA
Sites not aligning to the query:
5b1iA Crystal structure of k42a mutant of cystathionine beta-synthase from lactobacillus plantarum in a complex with l-methionine (see paper)
30% identity, 81% coverage: 11:252/300 of query aligns to 28:260/303 of 5b1iA
Sites not aligning to the query:
P16703 Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 from Escherichia coli (strain K12) (see paper)
32% identity, 93% coverage: 11:288/300 of query aligns to 27:286/303 of P16703
2bhtA Crystal structure of o-acetylserine sulfhydrylase b (see paper)
31% identity, 93% coverage: 11:288/300 of query aligns to 27:286/294 of 2bhtA
6ahiB Crystal structure of o-acetylserine dependent cystathionine beta- synthase from helicobacter pylori. (see paper)
28% identity, 88% coverage: 5:269/300 of query aligns to 26:281/306 of 6ahiB
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
31% identity, 94% coverage: 7:288/300 of query aligns to 27:300/310 of 5xoqA
3zeiA Structure of the mycobacterium tuberculosis o-acetylserine sulfhydrylase (oass) cysk1 in complex with a small molecule inhibitor (see paper)
29% identity, 94% coverage: 6:288/300 of query aligns to 26:299/300 of 3zeiA
2q3cA 2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi (see paper)
29% identity, 94% coverage: 6:288/300 of query aligns to 26:299/300 of 2q3cA
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 94% coverage: 6:288/300 of query aligns to 26:299/310 of P9WP55
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
29% identity, 94% coverage: 6:288/300 of query aligns to 26:299/306 of 2q3dA
2efyA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-acetylbutyric acid
31% identity, 86% coverage: 11:269/300 of query aligns to 26:277/302 of 2efyA
Sites not aligning to the query:
2ecqA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 3-hydroxylactate
31% identity, 86% coverage: 11:269/300 of query aligns to 26:277/302 of 2ecqA
Sites not aligning to the query:
2ecoA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-methylvalerate
31% identity, 86% coverage: 11:269/300 of query aligns to 26:277/302 of 2ecoA
Sites not aligning to the query:
8b9wA Cysteine synthase from trypanosoma theileri with plp bound (see paper)
31% identity, 93% coverage: 11:288/300 of query aligns to 35:305/329 of 8b9wA
5xenA Crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum in complex with l-serine-plp schiff base
27% identity, 93% coverage: 9:288/300 of query aligns to 26:299/300 of 5xenA
5xemA Crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum in complex with l-lanthionine-plp schiff base
27% identity, 93% coverage: 9:288/300 of query aligns to 26:299/302 of 5xemA
Sites not aligning to the query:
2isqA Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase (see paper)
29% identity, 97% coverage: 10:299/300 of query aligns to 29:313/320 of 2isqA
>PP_1113 FitnessBrowser__Putida:PP_1113
MSELISVSDRIYTKLEMNNPGGSHKYRAARRIVEHAVRKGEIIPGVTTVIEKTGGSFGFG
LLAACHKYQVAVELAVGLSFSQTKRDLLECFGARLIGKEMLMAGATPKDVVMHHLDNQAA
LGKSYFYTDQFNNPVGIEAHRYQTASELAVQLTNAGAGRQILFVGCAGTGASFTGITLGL
KDHGFDVSTVLVDPNGCDSRAGVFADHRFEGMAVGVCPPFMDWSLVDERAQVQHAEMLAA
QRWFYMQSGIFVGNTAAACLAVAQRMAQHPRYVETTLVTIAYDAGLWYQDLLGANRRKAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory