Comparing PP_1160 FitnessBrowser__Putida:PP_1160 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
32% identity, 97% coverage: 7:324/329 of query aligns to 1:300/306 of 7r5qA
1ho3A Crystal structure analysis of e. Coli l-asparaginase ii (y25f mutant) (see paper)
33% identity, 88% coverage: 36:324/329 of query aligns to 32:320/326 of 1ho3A
Sites not aligning to the query:
1jazA Crystal structure of monoclinic form of d90e mutant of escherichia coli asparaginase ii (see paper)
32% identity, 97% coverage: 7:324/329 of query aligns to 1:301/307 of 1jazA
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
33% identity, 88% coverage: 36:324/329 of query aligns to 54:342/348 of P00805
Sites not aligning to the query:
5k45A Wolinella succinogenes l-asparaginase p121 + l-glutamic acid (see paper)
31% identity, 95% coverage: 8:320/329 of query aligns to 2:319/328 of 5k45A
5k3oA Wolinella succinogenes l-asparaginase p121 and l-aspartic acid (see paper)
31% identity, 95% coverage: 8:320/329 of query aligns to 2:319/328 of 5k3oA
2wltA The crystal structure of helicobacter pylori l-asparaginase at 1.4 a resolution (see paper)
29% identity, 98% coverage: 7:328/329 of query aligns to 1:324/326 of 2wltA
7cbuA Blasnase-t13a with l-asp (see paper)
30% identity, 94% coverage: 9:317/329 of query aligns to 3:307/318 of 7cbuA
6pa3A E. Coli l-asparaginase ii double mutant (t89v,k162t) in complex with l-asn at ph 7.0 (see paper)
32% identity, 88% coverage: 36:324/329 of query aligns to 40:328/334 of 6pa3A
Sites not aligning to the query:
8h4aB Blasnase-t13a/m57p
30% identity, 94% coverage: 9:317/329 of query aligns to 3:310/328 of 8h4aB
7c8qA Blasnase-t13a with d-asn (see paper)
30% identity, 94% coverage: 9:317/329 of query aligns to 3:310/321 of 7c8qA
7c8xA Blasnase-t13a with l-asn (see paper)
30% identity, 94% coverage: 9:317/329 of query aligns to 3:309/319 of 7c8xA
P38986 L-asparaginase 1; L-asparaginase I; L-asparagine amidohydrolase I; ASP I; EC 3.5.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 95% coverage: 3:313/329 of query aligns to 49:360/381 of P38986
P10182 Glutaminase-asparaginase; L-ASNase/L-GLNase; L-asparagine/L-glutamine amidohydrolase; PGA; EC 3.5.1.38 from Pseudomonas sp. (strain ATCC 29598 / 7A) (see paper)
34% identity, 86% coverage: 43:324/329 of query aligns to 48:331/337 of P10182
Sites not aligning to the query:
2gvnA L-asparaginase from erwinia carotovora in complex with aspartic acid (see paper)
29% identity, 98% coverage: 6:328/329 of query aligns to 1:323/325 of 2gvnA
4pgaA Glutaminase-asparaginase from pseudomonas 7a (see paper)
33% identity, 86% coverage: 43:324/329 of query aligns to 41:324/330 of 4pgaA
Sites not aligning to the query:
1djpA Crystal structure of pseudomonas 7a glutaminase-asparaginase with the inhibitor don covalently bound in the active site (see paper)
33% identity, 86% coverage: 43:324/329 of query aligns to 41:324/330 of 1djpA
Sites not aligning to the query:
1djoA Crystal structure of pseudomonas 7a glutaminase-asparaginase with the inhibitor donv covalently bound in the active site (see paper)
33% identity, 86% coverage: 43:324/329 of query aligns to 41:324/330 of 1djoA
Sites not aligning to the query:
6wywA Crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-asp at ph 4.5
31% identity, 97% coverage: 7:324/329 of query aligns to 1:311/317 of 6wywA
2hlnA L-asparaginase from erwinia carotovora in complex with glutamic acid (see paper)
30% identity, 98% coverage: 6:328/329 of query aligns to 1:306/308 of 2hlnA
>PP_1160 FitnessBrowser__Putida:PP_1160
MSEHSSLPRLSIATLGGTVSMRAGAVGDGVTPSLDCERQLLQVPQLREMAQLNVASLCLL
PSASLGFATLLEVLAWARGEVERGAQALVLSQGTDSLEETAYFLDLLWPFDVPLVMTGAM
RSASQPGNDGPANLLAAAQVALAQDSRGRGVLVVMNDQVHCAARVRKTASLAMAAFESPG
CGPLGDVVEGVVLYRHPPGRRKVLPLPYRTDQRVALLEACLDADTALLQAVATLGYEGLV
IAGFGAGHVSASWSEVLEHLAPTLPVMVATRTGRGLTARATYGFAGAEIDLQKKGVYMAG
QLCPRKCRILLWLLIGTDRQHELQDWLQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory