SitesBLAST
Comparing PP_1163 FitnessBrowser__Putida:PP_1163 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
34% identity, 39% coverage: 304:569/678 of query aligns to 113:401/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (≠ H364), R206 (= R379), Q207 (≠ T380), Y208 (= Y381), S209 (= S382), S222 (= S395), E226 (≠ Q399), Q231 (vs. gap), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (≠ A402), S237 (= S403), V395 (≠ A563), G397 (= G565), P398 (= P566)
- binding protoporphyrin ix containing fe: Y126 (vs. gap), L129 (vs. gap), A130 (vs. gap), L133 (vs. gap)
Sites not aligning to the query:
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
34% identity, 39% coverage: 304:569/678 of query aligns to 113:401/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R379), Q207 (≠ T380), Y208 (= Y381), S209 (= S382), S222 (= S395), V223 (= V396), K224 (= K397), E226 (≠ Q399), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (≠ A402), S237 (= S403), V276 (= V442), T279 (= T445), V395 (≠ A563), F396 (= F564)
- binding protoporphyrin ix containing fe: Y126 (vs. gap), A130 (vs. gap), L133 (vs. gap)
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: P398 (= P566)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
34% identity, 39% coverage: 304:569/678 of query aligns to 113:401/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R379), Q207 (≠ T380), Y208 (= Y381), S209 (= S382), S222 (= S395), V223 (= V396), K224 (= K397), E226 (≠ Q399), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (≠ A402), S237 (= S403), V276 (= V442), T279 (= T445), F396 (= F564)
- binding protoporphyrin ix containing fe: Y126 (vs. gap), A130 (vs. gap), L133 (vs. gap)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
34% identity, 39% coverage: 304:569/678 of query aligns to 113:401/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R379), Q207 (≠ T380), Y208 (= Y381), S209 (= S382), S222 (= S395), V223 (= V396), K224 (= K397), E226 (≠ Q399), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (≠ A402), S237 (= S403), E394 (= E562), V395 (≠ A563), G397 (= G565), P398 (= P566)
- binding protoporphyrin ix containing fe: Y126 (vs. gap), L129 (vs. gap), A130 (vs. gap), L133 (vs. gap)
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: W122 (= W313), A125 (= A316), Y126 (vs. gap)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
34% identity, 39% coverage: 304:569/678 of query aligns to 113:401/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
32% identity, 37% coverage: 315:566/678 of query aligns to 135:392/396 of 1gvhA
- binding flavin-adenine dinucleotide: Y188 (≠ H364), R204 (= R379), Q205 (≠ T380), Y206 (= Y381), S207 (= S382), A220 (≠ S395), V221 (= V396), E224 (≠ Q399), G227 (= G400), Q228 (≠ P401), V229 (≠ A402), S230 (= S403), V269 (= V442), T272 (= T445), E388 (= E562), F390 (= F564)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 48, 50
- binding protoporphyrin ix containing fe: 43, 53, 56, 57, 60, 61, 81, 84, 85, 90, 94, 95, 127, 131, 393
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 37% coverage: 315:566/678 of query aligns to 135:392/396 of P24232
- E135 (= E315) active site, Charge relay system
Sites not aligning to the query:
- 29 mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; Y→F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- 95 active site, Charge relay system
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
36% identity, 34% coverage: 334:566/678 of query aligns to 7:237/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (≠ H364), R55 (= R379), Q56 (≠ T380), Y57 (= Y381), S58 (= S382), S71 (= S395), V72 (= V396), E75 (≠ Q399), N81 (vs. gap), G83 (vs. gap), L84 (vs. gap), V85 (vs. gap), S86 (vs. gap), T127 (= T445), E233 (= E562), F235 (= F564)
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
30% identity, 50% coverage: 337:678/678 of query aligns to 447:753/753 of 6laaA
- binding fe2/s2 (inorganic) cluster: S700 (≠ F623), C702 (= C625), E703 (≠ R626), G705 (= G628), C707 (= C630), G708 (= G631), C710 (= C633), C740 (= C661)
- binding flavin mononucleotide: R487 (= R379), Q488 (≠ T380), Y489 (= Y381), S490 (= S382), Q506 (≠ K397), S511 (≠ Q399), R512 (≠ G400), G514 (≠ A402), S515 (= S403), I553 (≠ V442), E651 (= E562), F653 (= F564)
Sites not aligning to the query:
- active site: 177, 251, 252, 359, 360, 361
- binding carbonate ion: 90, 91, 92, 241
- binding protoporphyrin ix containing fe: 54, 91, 92, 99, 103, 249, 252, 253, 298, 351, 352, 353, 357, 359, 361
Q03331 Flavohemoprotein; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Candida norvegensis (Yeast) (Candida mycoderma) (see paper)
26% identity, 38% coverage: 312:567/678 of query aligns to 143:386/390 of Q03331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
27% identity, 52% coverage: 325:678/678 of query aligns to 4:321/321 of 2piaA
- binding fe2/s2 (inorganic) cluster: S270 (≠ F623), C272 (= C625), E273 (≠ R626), G275 (= G628), C277 (= C630), G278 (= G631), C280 (= C633), C308 (= C661)
- binding flavin mononucleotide: N44 (≠ H364), R55 (= R379), T56 (= T380), Y57 (= Y381), S58 (= S382), A72 (≠ S395), V73 (= V396), G79 (≠ A398), R80 (≠ Q399), G82 (≠ P401), S83 (≠ A402), I121 (≠ V442), T124 (= T445), E223 (= E562), F225 (= F564)
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
27% identity, 52% coverage: 325:678/678 of query aligns to 5:322/322 of P33164
4g1bA X-ray structure of yeast flavohemoglobin in complex with econazole (see paper)
26% identity, 39% coverage: 304:567/678 of query aligns to 113:393/398 of 4g1bA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: Y126 (≠ D317)
- binding flavin-adenine dinucleotide: Y189 (≠ H364), R207 (= R379), H208 (≠ T380), Y209 (= Y381), S210 (= S382), A223 (≠ S395), K225 (= K397), E227 (≠ Q399), F233 (vs. gap), P234 (vs. gap), G236 (= G400), L237 (≠ P401), V238 (≠ A402), S239 (= S403), V282 (= V442), F390 (= F564)
- binding protoporphyrin ix containing fe: F133 (vs. gap), P392 (= P566), K393 (≠ S567)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 28, 29, 56, 57, 60, 102
- binding flavin-adenine dinucleotide: 46, 50, 84
- binding protoporphyrin ix containing fe: 42, 43, 44, 47, 60, 80, 81, 84, 85, 88, 90, 94, 95, 98, 394
7ylrA Structure of a bacteria protein
27% identity, 45% coverage: 359:666/678 of query aligns to 36:319/326 of 7ylrA
- binding fe2/s2 (inorganic) cluster: C276 (= C625), K277 (≠ R626), G279 (= G628), C281 (= C630), G282 (= G631), C284 (= C633), C314 (= C661)
- binding flavin mononucleotide: R56 (= R379), H57 (≠ T380), Y58 (= Y381), S59 (= S382), A79 (≠ R393), V80 (≠ I394), R81 (≠ S395), G86 (= G400), R87 (vs. gap), G89 (≠ A402), S90 (= S403), T131 (= T445), E229 (= E562), F231 (= F564), E233 (≠ Q577), R278 (≠ G627)
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
28% identity, 31% coverage: 357:567/678 of query aligns to 42:247/250 of 1tvcA
- active site: Y63 (= Y381), S64 (= S382), L215 (= L535)
- binding dihydroflavine-adenine dinucleotide: F49 (≠ H364), R61 (= R379), S62 (≠ T380), Y63 (= Y381), S64 (= S382), L78 (vs. gap), I79 (= I394), R80 (≠ S395), L82 (≠ K397), F87 (≠ A402), G128 (= G443), N155 (≠ R470), E159 (≠ D474), S186 (≠ E502), G187 (= G503), E242 (= E562), F244 (= F564), L245 (≠ G565)
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
29% identity, 35% coverage: 330:568/678 of query aligns to 100:333/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (≠ H364), R144 (= R379), Q145 (≠ T380), Y146 (= Y381), S147 (= S382), H161 (≠ S395), V162 (= V396), V165 (vs. gap), G168 (= G400), V169 (≠ P401), A170 (= A402), T171 (≠ S403), T214 (≠ V442), F329 (= F564), P331 (= P566), S333 (≠ T568)
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
29% identity, 35% coverage: 330:568/678 of query aligns to 101:334/334 of P0DPQ8
Sites not aligning to the query:
- 35 binding
- 40 binding
- 43 binding
- 75 binding
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
32% identity, 30% coverage: 336:538/678 of query aligns to 114:308/337 of 1krhA
- active site: C306 (= C536)
- binding flavin-adenine dinucleotide: Y143 (≠ H364), R155 (= R379), S156 (≠ T380), Y157 (= Y381), S158 (= S382), V171 (≠ L392), V172 (≠ R393), G178 (= G400), K179 (≠ P401), M180 (≠ A402), S181 (= S403), T219 (≠ V442)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 332, 334, 335, 336, 337
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 41, 43, 45, 46, 48, 82
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
23% identity, 35% coverage: 327:565/678 of query aligns to 7:289/289 of 2r6hC
- active site: C260 (= C536)
- binding flavin-adenine dinucleotide: Y43 (≠ H364), R86 (= R379), A87 (≠ T380), Y88 (= Y381), S89 (= S382), N103 (vs. gap), A107 (vs. gap), T108 (vs. gap), I122 (vs. gap), K123 (vs. gap), P124 (vs. gap), G125 (= G400), I126 (≠ P401), S127 (≠ A402), S128 (= S403), F288 (= F564)
6o0aA Crystal structure of flavohemoglobin from malassezia yamatoensis with bound fad and heme determined by iron sad phasing (see paper)
26% identity, 35% coverage: 332:565/678 of query aligns to 157:383/383 of 6o0aA
- binding flavin-adenine dinucleotide: Y190 (≠ H364), R205 (≠ Y381), Q206 (≠ S382), F207 (≠ L383), T208 (≠ S384), K222 (≠ S395), D224 (≠ K397), H226 (≠ Q399), G227 (= G400), E228 (≠ P401), M229 (≠ A402), T230 (≠ S403), T274 (= T445), E380 (= E562), F382 (= F564), G383 (= G565)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 48, 51, 52
- binding protoporphyrin ix containing fe: 44, 45, 46, 59, 62, 84, 85, 89, 92, 94, 98, 99, 102, 130, 133
Query Sequence
>PP_1163 FitnessBrowser__Putida:PP_1163
MQQSPDHRPSPWHAGEKTLQEKVGVAERMEAFGQKVIRDHMPDQHRTFYHQLPFMVAASV
DAQGRPWATLLEGPEGFVSSPDPRMLTIHTTLPADDPATPGLAAGQAVGLLGIELHTRRR
NRINGQIRHAAQGQLQVAVEQAFGNCPQYIQLRDYTRVTEPALGRIDATTLDTSTVSMIQ
AADTFFVASYVEHAYGQRSVDVSHRGGRPGFIKVEGNRLTIPDYAGNLHFNTLGNLVVNP
RAGLLFIDFKNGNVLQLYGRAEVLLDSPAIQAFEGAERLWTLQVEKVVWRPAAVALRWAF
KEYAPTSLMTGTWAEADARLEQRQQQRQWLAWRVLRVEQESRDIRSFYLEPPAGCRVAFA
PGQHLPVQVPRDGESALIRTYSLSSAPDDGFLRISVKAQGPASRYLHERVVAGDVLNVRP
PMGSFTLDQQSTRPLVLIGAGVGITPLLAMLRQQLRTGQARRIHLFHGARSLADLPFQQE
LAALRQQAGDLLQVHRALSQPEGHAQVGRDYEFAGRLGIEQVKATLALDDYDFYLCGPGS
FTQQLYEGLRGVHVPDARIHAEAFGPSTLRRHTDADQPVLQQPPAADEPVPVYFAASAKE
ARWVPGSGTLLELAEARGLAPEFSCRGGSCGTCKTRLVSGQVHYPNPPAELPEAGSVLIC
CAVPAKVEEGMQALVLDV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory