Comparing PP_1237 FitnessBrowser__Putida:PP_1237 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
77% identity, 100% coverage: 1:294/295 of query aligns to 1:291/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
77% identity, 100% coverage: 1:294/295 of query aligns to 1:291/292 of 3puoA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
59% identity, 99% coverage: 2:294/295 of query aligns to 2:291/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
59% identity, 99% coverage: 2:294/295 of query aligns to 2:291/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
59% identity, 99% coverage: 2:294/295 of query aligns to 2:291/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
59% identity, 99% coverage: 2:294/295 of query aligns to 2:291/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
59% identity, 99% coverage: 2:294/295 of query aligns to 2:291/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
59% identity, 99% coverage: 2:294/295 of query aligns to 2:291/291 of 3pueB
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
57% identity, 100% coverage: 1:294/295 of query aligns to 1:292/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
57% identity, 100% coverage: 1:294/295 of query aligns to 1:292/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
57% identity, 100% coverage: 1:294/295 of query aligns to 2:293/293 of 5t25A
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
56% identity, 100% coverage: 1:294/295 of query aligns to 1:292/292 of 3i7sA
4pfmA Shewanella benthica dhdps with lysine and pyruvate
52% identity, 100% coverage: 1:295/295 of query aligns to 2:294/295 of 4pfmA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
46% identity, 100% coverage: 1:295/295 of query aligns to 1:292/292 of Q07607
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
44% identity, 100% coverage: 1:294/295 of query aligns to 1:294/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
44% identity, 100% coverage: 1:294/295 of query aligns to 2:295/295 of 1o5kA
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
44% identity, 99% coverage: 1:293/295 of query aligns to 3:293/296 of 4m19A
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
44% identity, 99% coverage: 1:293/295 of query aligns to 3:293/296 of 6u01B
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
44% identity, 99% coverage: 1:293/295 of query aligns to 3:293/296 of 7kg2A
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
45% identity, 98% coverage: 1:290/295 of query aligns to 13:300/306 of 7kkdB
>PP_1237 FitnessBrowser__Putida:PP_1237
MIAGSMVALVTPMDAQGRVDWGSLDKLVDFHLENGTHAIVAVGTTGESATLDVEEHILVI
KHVVERVKRSAKPIPVIAGTGANSTAEAVHLTQNAKNAGADACLLVVPYYNKPTQEGLYQ
HFKHIAEAVDIPQILYNVPGRTSCDMQAETVIRLSTVPNIIGIKEATGDLARAKAILDGV
SKDFIVMSGDDPTAVELILMGGKGNISVTANVAPREMADLCEAALEGNAEKARAINEKLM
PLHKDLFCESNPIPVKWALVEMGLMQKGIRLPLTWLSEGCHEKVRTALRQSGVLV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory