Comparing PP_1378 FitnessBrowser__Putida:PP_1378 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 39% coverage: 62:230/429 of query aligns to 88:261/583 of Q9Y7Q9
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
24% identity, 77% coverage: 46:377/429 of query aligns to 32:381/446 of A0A0H2VG78
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
27% identity, 70% coverage: 78:378/429 of query aligns to 78:390/452 of Q5EXK5
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
28% identity, 36% coverage: 72:227/429 of query aligns to 92:241/444 of Q8NLB7
Sites not aligning to the query:
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 37% coverage: 80:238/429 of query aligns to 90:233/582 of O23492
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
28% identity, 34% coverage: 72:215/429 of query aligns to 70:223/491 of P0AGF4
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
28% identity, 34% coverage: 72:215/429 of query aligns to 66:219/475 of 4gc0A
Sites not aligning to the query:
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
28% identity, 34% coverage: 72:215/429 of query aligns to 66:219/475 of 4gbzA
Sites not aligning to the query:
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
28% identity, 34% coverage: 72:215/429 of query aligns to 66:219/475 of 4gbyA
Sites not aligning to the query:
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
33% identity, 19% coverage: 72:153/429 of query aligns to 203:276/727 of Q9Z2I6
Sites not aligning to the query:
>PP_1378 FitnessBrowser__Putida:PP_1378
MTSTYYTGEERSKRIFAIVGASSGNLVEWFDFYVYAFCAIYFAPAFFPSDDPTVQLLNTA
GVFAAGFLMRPIGGWIFGRLADRHGRKNSLMISVLMMCFGSLMIACLPTYASIGTWAPAL
LLLARLIQGLSVGGEYGTTATYMSEVALRGQRGFFASFQYVTLIGGQLLAVLVVVILQQL
LTEDELRAWGWRIPFVVGAIAALISLMLRRSLHETSSAEARNDKDAGSIGGLFRNHAAAF
ITVLGYTAGGSLIFYTFTTYMQKYLVNTAGMTAKNASYVMTGALFLFMVVQPFFGMLSDR
IGRRNSMLLFGGLGTLCTVPLLMALKTVTSPIMAFVLISLALCIVSFYTSISGLVKAEMF
PPQVRALGVGLAYAVANAAFGGSAEYVALGLKTLGMENTFYWYVTAMMAIAFLFSLRLPK
QAAYLHHDD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory