Comparing PP_1380 FitnessBrowser__Putida:PP_1380 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
48% identity, 95% coverage: 11:260/263 of query aligns to 11:259/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 95% coverage: 11:260/263 of query aligns to 11:263/268 of 6eb3B
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 95% coverage: 11:260/263 of query aligns to 11:257/262 of 6eb3C
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 95% coverage: 11:260/263 of query aligns to 11:260/265 of 6eb3A
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
27% identity, 91% coverage: 22:260/263 of query aligns to 27:267/278 of 4uhfA
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
27% identity, 91% coverage: 22:260/263 of query aligns to 27:267/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
27% identity, 91% coverage: 22:260/263 of query aligns to 27:267/274 of 4uhdA
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
26% identity, 87% coverage: 10:238/263 of query aligns to 5:237/264 of 5zhsA
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
26% identity, 87% coverage: 10:238/263 of query aligns to 7:239/266 of 6ap8A
Sites not aligning to the query:
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
26% identity, 87% coverage: 10:238/263 of query aligns to 7:239/266 of 5dj5A
Sites not aligning to the query:
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
26% identity, 87% coverage: 10:238/263 of query aligns to 6:238/265 of 5zhtA
5zhrA Crystal structure of osd14 in complex with covalently bound kk094 (see paper)
26% identity, 87% coverage: 10:238/263 of query aligns to 6:238/265 of 5zhrA
5yz7A Crystal structure of osd14 in complex with d-ring-opened 7'-carba-4bd (see paper)
26% identity, 87% coverage: 10:238/263 of query aligns to 6:238/265 of 5yz7A
Q10QA5 Strigolactone esterase D14; Protein DWARF 14; Protein DWARF 88; Protein HIGH-TILLERING DWARF 2; EC 3.1.-.- from Oryza sativa subsp. japonica (Rice) (see 4 papers)
26% identity, 87% coverage: 10:238/263 of query aligns to 59:291/318 of Q10QA5
Sites not aligning to the query:
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
26% identity, 87% coverage: 10:238/263 of query aligns to 9:241/268 of 4ihaA
Sites not aligning to the query:
6brtA F-box protein cth with hydrolase (see paper)
26% identity, 87% coverage: 10:238/263 of query aligns to 26:258/285 of 6brtA
Q9SQR3 Strigolactone esterase D14; Protein DWARF 14; AtD14; EC 3.1.-.- from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
25% identity, 86% coverage: 11:237/263 of query aligns to 10:240/267 of Q9SQR3
7c8lA Hybrid designing of potent inhibitors of striga strigolactone receptor shhtl7 (see paper)
23% identity, 87% coverage: 24:251/263 of query aligns to 18:253/268 of 7c8lA
5z7yA Crystal structure of striga hermonthica htl7 (shhtl7) (see paper)
23% identity, 87% coverage: 24:251/263 of query aligns to 19:254/267 of 5z7yA
7snuA Crystal structure of shhtl7 from striga hermonthica in complex with strigolactone antagonist rg6 (see paper)
23% identity, 87% coverage: 24:251/263 of query aligns to 21:256/270 of 7snuA
>PP_1380 FitnessBrowser__Putida:PP_1380
MAHLQLADGVLNYQIDGPDDAPVLVLSNSLGTDLGMWDTQIPLWSQHFRVLRYDTRGHGA
SLVTEGPYSIEQLGRDVLALLDGLDIQKAHFVGLSMGGLIGQWLGIHAGERLHSLTLCNT
AAKIANDEVWNTRIDTVLKGGQQAMVDLRDASIARWFTPGFAQAQAEQAQRICQMLAQTS
PQGYAGNCAAVRDADYREQLGRIQVPALIVAGTQDVVTTPEHGRFMQAGIQGAEYVDFPA
AHLSNVEIGEAFSRRVLDFLLAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory