Comparing PP_1400 FitnessBrowser__Putida:PP_1400 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
28% identity, 37% coverage: 88:249/439 of query aligns to 63:220/446 of A0A0H2VG78
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 35% coverage: 82:235/439 of query aligns to 98:258/583 of Q9Y7Q9
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
25% identity, 80% coverage: 82:431/439 of query aligns to 66:463/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
25% identity, 80% coverage: 82:431/439 of query aligns to 66:463/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
25% identity, 80% coverage: 82:431/439 of query aligns to 66:463/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
25% identity, 80% coverage: 82:431/439 of query aligns to 70:467/491 of P0AGF4
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 70% coverage: 78:384/439 of query aligns to 186:499/616 of P36035
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 48% coverage: 21:230/439 of query aligns to 37:244/444 of Q8NLB7
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 70% coverage: 72:379/439 of query aligns to 55:342/403 of P77589
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 35% coverage: 92:245/439 of query aligns to 93:230/580 of Q9C757
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
22% identity, 52% coverage: 3:232/439 of query aligns to 18:265/572 of O42885
Sites not aligning to the query:
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 35% coverage: 92:245/439 of query aligns to 92:229/582 of O23492
Sites not aligning to the query:
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 34% coverage: 93:240/439 of query aligns to 108:245/514 of Q9LT15
Sites not aligning to the query:
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
27% identity, 39% coverage: 69:240/439 of query aligns to 63:225/468 of 7spsA
Sites not aligning to the query:
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
27% identity, 39% coverage: 69:240/439 of query aligns to 64:226/469 of 7crzA
Sites not aligning to the query:
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
27% identity, 39% coverage: 69:240/439 of query aligns to 66:228/470 of 4zw9A
Sites not aligning to the query:
5c65A Structure of the human glucose transporter glut3 / slc2a3
27% identity, 39% coverage: 69:240/439 of query aligns to 62:224/457 of 5c65A
Sites not aligning to the query:
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
27% identity, 39% coverage: 69:240/439 of query aligns to 66:228/496 of P11169
Sites not aligning to the query:
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
27% identity, 39% coverage: 69:240/439 of query aligns to 66:228/470 of 7sptA
Sites not aligning to the query:
8fvzA Pipt y150a
24% identity, 37% coverage: 24:186/439 of query aligns to 2:161/433 of 8fvzA
Sites not aligning to the query:
>PP_1400 FitnessBrowser__Putida:PP_1400
MDNATSLPAGAATAPAAEKTTASRLKSIFSGSIGNMVEWYDWYVYAAFSLYFAKAFFPAG
DSTAQLLNTAAIFAVGFLMRPIGGWLMGLYADRKGRKAALMASVLLMCAGSLVIALTPGY
ETIGVAAPVLLVIARLLQGLSVGGEYGTSATYLSEMASKERRGFFSSFQYVTLISGQLIA
LAVLIVLQQTLTTEQLYAWGWRVPFVIGALCAVVALYLRRGMEETASFTKKEKAKESLMR
TLLRHPKELMTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQ
PMIGGLSDKIGRRPILIAFGVLGTLFTVPILSTLHTIQTWWGAFFLIMAALIIVSGYTSI
NAVVKAELFPTEIRALGVGLPYALTVSIFGGTAEYVALWFKSAGMESGFYWYVTACIACS
LLVYATMKDTKQHSRITTE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory