Comparing PP_1418 FitnessBrowser__Putida:PP_1418 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
2dvzA Structure of a periplasmic transporter (see paper)
29% identity, 72% coverage: 30:263/326 of query aligns to 8:235/300 of 2dvzA
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
27% identity, 68% coverage: 26:247/326 of query aligns to 2:215/302 of 8hkbA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
23% identity, 89% coverage: 30:320/326 of query aligns to 6:289/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
23% identity, 89% coverage: 30:320/326 of query aligns to 6:289/294 of 7ndsA
2f5xB Structure of periplasmic binding protein bugd (see paper)
25% identity, 61% coverage: 127:324/326 of query aligns to 103:297/300 of 2f5xB
Sites not aligning to the query:
>PP_1418 FitnessBrowser__Putida:PP_1418
MTFSLRRLVLATGCLLLAGNALAAEPKRPECIAPASPGGGFDLTCKLVQSALVQEKILSK
PMRVTYMPGGVGAVAYNAVVAQRPADAGTLVAWSSGSLLNLAQGKFGRFDENAVKWLAAV
GTSYGAIAVKSDSPYKTLDDLVAALKKDPSKVVIGSGGTVGSQDWMQTALIAKAAGINPR
DLRYVALEGGGEIATALLGGHIQVGSTDISDSMPHIQSGNMRILAVFSENRLNEPEMKDI
PTAKEQGYDIVWPVVRGFYLGPKVSDEDYAWWKASFDKMLASEDFAKLRDQRELFPFAMT
GEELDGYVKKQVADYKALAKEFGLIQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory