Comparing PP_1676 FitnessBrowser__Putida:PP_1676 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
29% identity, 73% coverage: 4:243/330 of query aligns to 8:268/364 of P97084
Sites not aligning to the query:
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
29% identity, 73% coverage: 4:243/330 of query aligns to 5:265/358 of 1lc7A
Sites not aligning to the query:
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
29% identity, 73% coverage: 4:243/330 of query aligns to 1:261/355 of 1lkcA
Sites not aligning to the query:
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
29% identity, 73% coverage: 4:243/330 of query aligns to 2:262/356 of 1lc8A
Sites not aligning to the query:
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
33% identity, 45% coverage: 113:259/330 of query aligns to 133:271/353 of 7szpA
Sites not aligning to the query:
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
28% identity, 55% coverage: 126:307/330 of query aligns to 134:313/328 of 1uu0A
Sites not aligning to the query:
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 55% coverage: 126:307/330 of query aligns to 140:319/335 of Q9X0D0
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
28% identity, 55% coverage: 126:307/330 of query aligns to 141:320/335 of 2f8jA
Sites not aligning to the query:
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
28% identity, 55% coverage: 126:307/330 of query aligns to 135:314/329 of 1uu1A
Sites not aligning to the query:
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
28% identity, 55% coverage: 126:307/330 of query aligns to 135:314/329 of 1h1cA
Sites not aligning to the query:
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
28% identity, 58% coverage: 113:305/330 of query aligns to 119:306/335 of 1geyA
Sites not aligning to the query:
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
28% identity, 58% coverage: 113:305/330 of query aligns to 133:320/354 of 1fg7A
Sites not aligning to the query:
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
28% identity, 58% coverage: 113:305/330 of query aligns to 133:320/354 of 1fg3A
Sites not aligning to the query:
P0DV65 L-serine phosphate decarboxylase; CobD homolog SMUL_1544; SmCobD; L-serine O-phosphate decarboxylase; L-Ser-P decarboxylase; Norcobamide biosynthesis protein SMUL_1544; Threonine phosphate decarboxylase-like enzyme; EC 4.1.1.- from Sulfurospirillum multivorans (strain DM 12446 / JCM 15788 / NBRC 109480) (see paper)
34% identity, 30% coverage: 126:225/330 of query aligns to 171:276/392 of P0DV65
Sites not aligning to the query:
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
24% identity, 62% coverage: 94:296/330 of query aligns to 121:333/366 of 3cq5B
Sites not aligning to the query:
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
24% identity, 62% coverage: 94:296/330 of query aligns to 119:331/364 of 3cq6A
Sites not aligning to the query:
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
24% identity, 63% coverage: 91:297/330 of query aligns to 110:334/369 of 4wbtA
Sites not aligning to the query:
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
26% identity, 52% coverage: 128:300/330 of query aligns to 159:332/360 of 8bj3A
Sites not aligning to the query:
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
26% identity, 64% coverage: 120:329/330 of query aligns to 137:352/354 of 3ly1D
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
31% identity, 42% coverage: 126:264/330 of query aligns to 163:300/369 of 4r8dA
Sites not aligning to the query:
>PP_1676 FitnessBrowser__Putida:PP_1676
MLEHGGRLLRAVQQYGIPREQWLDLSSGIAPWPFPVPPIPVDAWARLPETEDGLEDAARA
YYGARQLLPVAGSQAAIQALPLLRTTARVGVLTPCYAEHPYAWQRAGHQLLALDEAQVEA
ALDGLDVLVLVNPNNPTGQRVSRERLLAWHARLAARGGWLLVDEAFMDNTPADSVVDCAE
RPGLIVLRSFGKFFGLAGVRLGFVAAEHSLLLRLAELLGPWTVNGPTRVLAQASLSDETA
QRAQAQRCAAASQRLAHVLRSAGLAPSGGCDLFQYVRSEHAARLHEFLARRGILVRLFEQ
PAAVRLGLPACAADEQRLAQALAAYQKETA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory