SitesBLAST
Comparing PP_1705 FitnessBrowser__Putida:PP_1705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
34% identity, 24% coverage: 108:314/850 of query aligns to 103:313/539 of 8a56B
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 6, 7, 9, 11, 32, 33, 42, 80, 422, 423
- binding 3'-phosphate-adenosine-5'-diphosphate: 17, 18, 21, 70, 356, 430, 435, 438, 505, 506, 509
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 38% coverage: 9:328/850 of query aligns to 3:320/384 of Q9HTK9
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
27% identity, 39% coverage: 53:381/850 of query aligns to 41:399/541 of 6pfzA
- active site: C42 (≠ V54)
- binding calcium ion: D306 (≠ S303), T332 (≠ S326)
- binding coenzyme a: C42 (≠ V54), K76 (≠ N79), R313 (≠ L311)
- binding flavin-adenine dinucleotide: R41 (= R53), C42 (≠ V54), A86 (≠ V89), A115 (= A114), T116 (= T115), G117 (= G116), L136 (≠ Y135), G286 (= G285), D287 (≠ E286), P303 (= P300), F304 (≠ G301), G305 (≠ Y302)
Sites not aligning to the query:
- active site: 37, 455, 456
- binding calcium ion: 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
32% identity, 38% coverage: 10:328/850 of query aligns to 1:317/381 of 2v3aA
- active site: L11 (≠ M20), K42 (≠ R53), P43 (≠ V54), M290 (≠ Y302)
- binding flavin-adenine dinucleotide: I7 (≠ V16), G8 (= G17), T9 (≠ N18), G10 (= G19), A12 (≠ V21), T33 (≠ G44), A34 (≠ E45), D35 (≠ E46), K42 (≠ R53), P43 (≠ V54), R79 (≠ A88), V80 (= V89), A105 (= A114), W106 (≠ T115), G107 (= G116), I153 (≠ L162), F157 (≠ A166), D274 (≠ E286), L284 (≠ G296), Y285 (≠ L297), V286 (= V298), K317 (= K328)
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
29% identity, 38% coverage: 11:337/850 of query aligns to 4:345/422 of 1q1wA
- active site: L13 (≠ M20), L44 (≠ R53), P45 (≠ V54), L305 (≠ Y302)
- binding flavin-adenine dinucleotide: G10 (= G17), G12 (= G19), L13 (≠ M20), A14 (≠ V21), G35 (= G44), D36 (≠ E45), L44 (≠ R53), P45 (≠ V54), K49 (≠ E58), V82 (= V89), A108 (= A114), T109 (= T115), G110 (= G116), R133 (= R136), I159 (≠ L162), D283 (≠ E286), S300 (vs. gap), V301 (= V298), W329 (≠ T321)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
29% identity, 38% coverage: 11:337/850 of query aligns to 5:346/422 of P16640
- A15 (≠ V21) binding
- D37 (≠ E45) binding
- K50 (≠ E58) binding
- V83 (= V89) binding
- R134 (= R136) binding
- D284 (≠ E286) binding
- V302 (= V298) binding
3ictA Crystal structure of reduced bacillus anthracis coadr-rhd (see paper)
26% identity, 37% coverage: 56:370/850 of query aligns to 49:368/557 of 3ictA
- active site: N309 (≠ Y302)
- binding coenzyme a: N309 (≠ Y302), R313 (= R306)
- binding flavin-adenine dinucleotide: V85 (= V89), S116 (≠ A114), P117 (≠ T115), G118 (= G116), L138 (≠ Y135), G286 (= G285), D287 (≠ E286), P303 (≠ G296), L304 (= L297), A305 (≠ V298)
Sites not aligning to the query:
- active site: 15, 42, 46, 47, 430, 456, 457
- binding coenzyme a: 15, 18, 22, 23, 26, 43, 46, 47, 439, 451, 520, 521, 524
- binding flavin-adenine dinucleotide: 12, 14, 16, 37, 38, 46, 47
3icsB Crystal structure of partially reduced bacillus anthracis coadr-rhd (see paper)
26% identity, 37% coverage: 56:370/850 of query aligns to 46:365/554 of 3icsB
- active site: N306 (≠ Y302)
- binding adenosine-5'-diphosphate: G162 (= G160), I164 (≠ L162), E183 (= E181), M184 (≠ F182), P190 (= P188), I244 (≠ A246), G245 (= G247)
- binding coenzyme a: N306 (≠ Y302), R310 (= R306)
- binding flavin-adenine dinucleotide: V82 (= V89), S113 (≠ A114), P114 (≠ T115), G115 (= G116), L135 (≠ Y135), R136 (= R136), I164 (≠ L162), L252 (= L254), G283 (= G285), D284 (≠ E286), P300 (≠ G296), L301 (= L297), A302 (≠ V298), A305 (≠ G301)
Sites not aligning to the query:
- active site: 12, 39, 43, 44, 427, 453, 454
- binding coenzyme a: 12, 15, 16, 19, 20, 23, 40, 43, 44, 428, 436, 441, 444, 445, 448, 517, 518, 521
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 34, 35, 43, 44
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
30% identity, 39% coverage: 12:344/850 of query aligns to 2:317/359 of Q8U1K9
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
30% identity, 39% coverage: 12:344/850 of query aligns to 2:317/346 of 1xhcA
- active site: P10 (≠ M20), K38 (≠ R53), P39 (≠ V54), F145 (≠ L161), E149 (= E165), M276 (≠ Y302)
- binding flavin-adenine dinucleotide: V6 (= V16), G7 (= G17), G9 (= G19), P10 (≠ M20), G11 (≠ V21), D29 (≠ G44), K30 (≠ E45), K38 (≠ R53), P39 (≠ V54), E74 (≠ A88), A75 (≠ V89), A100 (= A114), T101 (= T115), G102 (= G116), L119 (≠ Y135), R120 (= R136), F145 (≠ L161), I146 (≠ L162), E149 (= E165), G259 (= G285), D260 (≠ E286), G270 (= G296), T271 (≠ L297), A272 (≠ V298)
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
27% identity, 36% coverage: 39:340/850 of query aligns to 28:362/565 of 3nt6A
- active site: V38 (≠ R49), N42 (≠ R53), S43 (≠ V54), N325 (≠ Y302)
- binding coenzyme a: S39 (≠ A50), N42 (≠ R53), S43 (≠ V54), A321 (≠ V298), N325 (≠ Y302), R329 (= R306)
- binding flavin-adenine dinucleotide: E33 (≠ G44), R34 (≠ E45), N42 (≠ R53), S43 (≠ V54), E80 (≠ A88), V81 (= V89), S112 (≠ A114), P113 (≠ T115), G114 (= G116), L133 (≠ Y135), R134 (= R136), F161 (≠ L161), G302 (= G285), D303 (≠ E286), P319 (vs. gap), L320 (= L297), A321 (≠ V298)
Sites not aligning to the query:
- active site: 11, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
27% identity, 44% coverage: 14:389/850 of query aligns to 4:384/424 of 8c0zE
5vn0A Water-forming nadh oxidase from lactobacillus brevis (lbnox) bound to nadh. (see paper)
25% identity, 44% coverage: 12:387/850 of query aligns to 3:395/449 of 5vn0A
- active site: H11 (≠ M20), I38 (≠ R49), L41 (≠ D52), S42 (≠ R53), C43 (≠ V54), Q75 (≠ H84), T102 (≠ R105), A277 (= A283), A282 (= A288), A283 (≠ S289), V302 (≠ A309)
- binding flavin-adenine dinucleotide: G8 (= G17), T10 (≠ G19), H11 (≠ M20), A12 (≠ V21), E33 (≠ G44), R34 (≠ E45), N35 (≠ E46), S42 (≠ R53), C43 (≠ V54), N79 (≠ A88), V80 (= V89), T111 (≠ A114), S112 (≠ T115), G113 (= G116), K133 (≠ R136), G279 (= G285), D280 (≠ E286), L297 (≠ M304), A298 (= A305)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G157 (= G160), Y158 (≠ L161), I159 (≠ L162), E162 (= E165), D178 (≠ E181), A179 (≠ F182), K186 (≠ V189), Y187 (≠ Q190), I241 (≠ A246), G242 (= G247), F243 (≠ I248), P296 (= P300), L297 (≠ M304)
Sites not aligning to the query:
5er0A Water-forming nadh oxidase from lactobacillus brevis (lbnox) (see paper)
25% identity, 44% coverage: 12:387/850 of query aligns to 3:395/450 of 5er0A
- active site: H11 (≠ M20), I38 (≠ R49), L41 (≠ D52), S42 (≠ R53), C43 (≠ V54), Q75 (≠ H84), T102 (≠ R105), A277 (= A283), A282 (= A288), A283 (≠ S289), V302 (≠ A309)
- binding flavin-adenine dinucleotide: G8 (= G17), T10 (≠ G19), H11 (≠ M20), A12 (≠ V21), E33 (≠ G44), R34 (≠ E45), S42 (≠ R53), C43 (≠ V54), N79 (≠ A88), V80 (= V89), S112 (≠ T115), G113 (= G116), K133 (≠ R136), Y158 (≠ L161), I159 (≠ L162), N246 (≠ Q251), G279 (= G285), D280 (≠ E286), P296 (= P300), L297 (≠ M304), A298 (= A305)
Sites not aligning to the query:
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
29% identity, 36% coverage: 11:316/850 of query aligns to 2:311/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G17), G10 (= G19), H11 (≠ M20), A12 (≠ V21), D34 (≠ E45), E35 (= E46), R42 (= R53), P43 (≠ V54), S46 (= S57), K47 (≠ E58), R78 (≠ A88), M79 (≠ V89), T106 (= T115), R127 (= R136), I153 (≠ L162), D275 (≠ E286), S292 (≠ L297), V293 (= V298)
Sites not aligning to the query:
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
31% identity, 33% coverage: 13:290/850 of query aligns to 5:279/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G19), V12 (≠ M20), G13 (≠ V21), D35 (≠ E45), E36 (= E46), R43 (= R53), P44 (≠ V54), S47 (= S57), K48 (≠ E58), V80 (= V89), T107 (= T115), G108 (= G116), R128 (= R136), G274 (= G285), D275 (≠ E286)
Sites not aligning to the query:
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
31% identity, 33% coverage: 13:290/850 of query aligns to 4:278/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G19), V11 (≠ M20), G12 (≠ V21), D34 (≠ E45), E35 (= E46), R42 (= R53), P43 (≠ V54), K47 (≠ E58), E78 (≠ A88), V79 (= V89), T106 (= T115), G107 (= G116), G273 (= G285), D274 (≠ E286)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ F120), G149 (= G158), L152 (= L161), I153 (≠ L162), E156 (= E165), E172 (= E181), A173 (≠ F182), R180 (≠ V189), V236 (≠ A246), G237 (= G247), A238 (≠ I248)
Sites not aligning to the query:
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
31% identity, 25% coverage: 76:289/850 of query aligns to 68:284/443 of 6rvhA
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 20, 23, 40, 41, 44, 63, 303, 307, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 34, 35, 43, 44, 297, 298, 299, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
31% identity, 25% coverage: 76:289/850 of query aligns to 68:284/443 of 6rvbA
- active site: Y159 (≠ L161), E163 (= E165)
- binding flavin-adenine dinucleotide: E80 (≠ A88), V81 (= V89), T113 (= T115), G114 (= G116), L133 (≠ Y135), R134 (= R136), I160 (≠ L162), G280 (= G285), D281 (≠ E286)
- binding nicotinamide-adenine-dinucleotide: G156 (= G158), G158 (= G160), Y159 (≠ L161), I160 (≠ L162), E179 (= E181), A180 (≠ F182), A240 (≠ S245), T241 (≠ A246), G242 (= G247)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 15, 20, 23, 40, 41, 44, 63, 303, 307, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 43, 44, 298, 299, 424, 425
- binding nicotinamide-adenine-dinucleotide: 297, 328, 329
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
31% identity, 25% coverage: 76:289/850 of query aligns to 68:284/443 of 6ruzA
- active site: Y159 (≠ L161), E163 (= E165)
- binding flavin-adenine dinucleotide: E80 (≠ A88), V81 (= V89), T113 (= T115), G114 (= G116), A115 (≠ S117), L133 (≠ Y135), R134 (= R136), Y159 (≠ L161), G280 (= G285), D281 (≠ E286)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 15, 19, 20, 23, 40, 41, 44, 63, 303, 307, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 43, 44, 297, 298, 299, 424, 425
Query Sequence
>PP_1705 FitnessBrowser__Putida:PP_1705
MKATASSGQRERLVIVGNGMVGHHCVEQLVSRGALQRFEVRVFGEERQRAYDRVHLSEYF
GGSCAETLALCEHDFYEANGVHLHLGEAVLEIDRERREVVTAAGRYGYDQLVLATGSYPF
VPPIEGSSGNARLVYRTLDDLDGIRAAAAGARRGVVVGGGLLGLEAANALKSLGLEAHVV
EFAPRLMPVQLDGEGGAALKAQIEALGVGVHLSRATQSVSAGETYRYRMNFDGGEHLETD
LIVFSAGIRPQDALGRGCGLDIAARGGVVIDNHCRSSDPRIFAIGECASWNGSVFGLVAP
GYSMARNLAGLLMGEAAVAFTGADMSTKLKLLGVDVGSIGDAHGATPGARSYRFIDEANS
AYRRLVVDASGKHVLGAVLVGDNSYYDTLLQYAQNGIALPADPAALILPQGGGAPALGAD
ALPDSATICSCHNVSKGAVCAAIDSGCSDLAAVKGCTKAATGCGGCAALLKQVFEHELTA
RGVAVDKSLCEHFAYTRQELYGLVRVEGIRTFSELLERHGKGHLGCDICKPAVGNILASC
WNQPIMDPALVPLQDTNDTFMANMQKNGTYSVVPRIPGGEITPDKLIVIGQVAKKYDLYT
KITGGQRIDLFGAQLHELPLIWGELIEAGFETGHAYGKSTRTVKSCVGSTWCRYGVQDSV
AMALRLEDRYKGLRSPHKLKFAVSGCTRECAEAQSKDIGVIATDKGWNLYVCGNGGMRPR
HAELFATDLDDEALVRLIDRVLMFYIRTADKLQRTSVWRENLEGGLDYLKQVIIDDSLGL
ASELESQMQHVVDQYECEWANALNDPEKLKRFRTFVNDRRADPDVHFVREREQRRPAAPL
HLIPTVEEAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory