SitesBLAST
Comparing PP_1707 FitnessBrowser__Putida:PP_1707 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
42% identity, 97% coverage: 5:309/316 of query aligns to 6:306/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
42% identity, 97% coverage: 5:309/316 of query aligns to 4:304/311 of 3bazA
- active site: L98 (= L100), R230 (= R235), A251 (= A256), D254 (= D259), E259 (= E264), H277 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V76), G149 (= G156), L150 (≠ M157), G151 (= G158), R152 (= R159), I153 (≠ V160), S172 (≠ T178), R173 (≠ D179), S174 (≠ L180), C201 (≠ A207), P202 (≠ A208), T207 (≠ G212), I228 (= I233), G229 (≠ A234), R230 (= R235), D254 (= D259), H277 (= H282), G279 (≠ A284)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
42% identity, 93% coverage: 14:307/316 of query aligns to 14:302/319 of 5v6qB
- active site: L96 (= L100), R230 (= R235), D254 (= D259), E259 (= E264), H277 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V76), V100 (= V104), F148 (≠ V155), L150 (≠ M157), G151 (= G158), R152 (= R159), I153 (≠ V160), T172 (= T178), R173 (≠ D179), V201 (≠ A207), P202 (≠ A208), S206 (≠ G212), T207 (≠ E213), V228 (≠ I233), G229 (≠ A234), R230 (= R235), H277 (= H282), A279 (= A284)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
42% identity, 93% coverage: 14:307/316 of query aligns to 13:301/319 of 5v7nA
- active site: L95 (= L100), R229 (= R235), D253 (= D259), E258 (= E264), H276 (= H282)
- binding 2-keto-D-gluconic acid: G70 (= G75), V71 (= V76), G72 (= G77), R229 (= R235), H276 (= H282), S279 (= S285), R285 (= R291)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V76), V99 (= V104), L149 (≠ M157), G150 (= G158), R151 (= R159), I152 (≠ V160), T171 (= T178), R172 (≠ D179), V200 (≠ A207), P201 (≠ A208), S205 (≠ G212), T206 (≠ E213), V227 (≠ I233), G228 (≠ A234), R229 (= R235), H276 (= H282), A278 (= A284)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
42% identity, 93% coverage: 14:307/316 of query aligns to 12:300/318 of 5j23A
- active site: L94 (= L100), R228 (= R235), D252 (= D259), E257 (= E264), H275 (= H282)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V76), L148 (≠ M157), G149 (= G158), R150 (= R159), I151 (≠ V160), T170 (= T178), R171 (≠ D179), P200 (≠ A208), S204 (≠ G212), T205 (≠ E213), R228 (= R235)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
42% identity, 93% coverage: 14:307/316 of query aligns to 12:300/317 of 5v7gA
- active site: L94 (= L100), R228 (= R235), D252 (= D259), E257 (= E264), H275 (= H282)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V76), V98 (= V104), F146 (≠ V155), L148 (≠ M157), G149 (= G158), R150 (= R159), I151 (≠ V160), T170 (= T178), R171 (≠ D179), V199 (≠ A207), P200 (≠ A208), S204 (≠ G212), T205 (≠ E213), V226 (≠ I233), G227 (≠ A234), R228 (= R235), H275 (= H282), A277 (= A284)
- binding oxalate ion: G69 (= G75), V70 (= V76), G71 (= G77), R228 (= R235), H275 (= H282)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
38% identity, 87% coverage: 41:315/316 of query aligns to 41:321/334 of 5aovA
- active site: L100 (= L100), R241 (= R235), D265 (= D259), E270 (= E264), H288 (= H282)
- binding glyoxylic acid: M52 (≠ G52), L53 (≠ G53), L53 (≠ G53), Y74 (≠ N74), A75 (≠ G75), V76 (= V76), G77 (= G77), R241 (= R235), H288 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V76), T104 (≠ V104), F158 (≠ M157), G159 (= G158), R160 (= R159), I161 (≠ V160), S180 (vs. gap), R181 (vs. gap), A211 (= A206), V212 (≠ A207), P213 (≠ A208), T218 (≠ E213), I239 (= I233), A240 (= A234), R241 (= R235), H288 (= H282), G290 (≠ A284)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
37% identity, 87% coverage: 41:315/316 of query aligns to 40:320/332 of 6biiA
- active site: L99 (= L100), R240 (= R235), D264 (= D259), E269 (= E264), H287 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V76), T103 (≠ V104), G156 (= G156), F157 (≠ M157), G158 (= G158), R159 (= R159), I160 (≠ V160), A179 (vs. gap), R180 (vs. gap), S181 (vs. gap), K183 (vs. gap), V211 (≠ A207), P212 (≠ A208), E216 (≠ G212), T217 (≠ E213), V238 (≠ I233), A239 (= A234), R240 (= R235), D264 (= D259), H287 (= H282), G289 (≠ A284)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
36% identity, 100% coverage: 1:315/316 of query aligns to 1:321/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
36% identity, 100% coverage: 1:315/316 of query aligns to 1:321/333 of 2dbqA
- active site: L100 (= L100), R241 (= R235), D265 (= D259), E270 (= E264), H288 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V76), T104 (≠ V104), L158 (≠ M157), G159 (= G158), R160 (= R159), I161 (≠ V160), S180 (≠ T178), R181 (≠ D179), T182 (≠ L180), A211 (= A206), V212 (≠ A207), P213 (≠ A208), T218 (≠ E213), I239 (= I233), A240 (= A234), R241 (= R235), D265 (= D259), H288 (= H282), G290 (≠ A284)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
33% identity, 88% coverage: 30:308/316 of query aligns to 26:304/304 of 1wwkA
- active site: S96 (≠ L100), R230 (= R235), D254 (= D259), E259 (= E264), H278 (= H282)
- binding nicotinamide-adenine-dinucleotide: V100 (= V104), G146 (= G156), F147 (≠ M157), G148 (= G158), R149 (= R159), I150 (≠ V160), Y168 (≠ T178), D169 (= D179), P170 (= P186), V201 (≠ A206), P202 (≠ A207), T207 (≠ G212), T228 (≠ I233), S229 (≠ A234), D254 (= D259), H278 (= H282), G280 (≠ A284)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
30% identity, 86% coverage: 45:315/316 of query aligns to 47:316/533 of O43175
- T78 (≠ V76) binding
- R135 (≠ T133) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ RV 159:160) binding
- D175 (≠ T178) binding
- T207 (≠ A207) binding
- CAR 234:236 (≠ IAR 233:235) binding
- D260 (= D259) binding
- V261 (= V260) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HRAS 282:285) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
30% identity, 84% coverage: 45:308/316 of query aligns to 43:305/305 of 6plfA
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
34% identity, 75% coverage: 67:303/316 of query aligns to 70:310/324 of 2gcgA
- active site: L103 (= L100), R241 (= R235), D265 (= D259), E270 (= E264), H289 (= H282)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G75), V79 (= V76), G80 (= G77), R241 (= R235), H289 (= H282)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V76), T107 (≠ V104), G156 (= G156), G158 (= G158), I160 (≠ V160), G180 (≠ D179), R181 (≠ L180), R184 (≠ L183), C212 (≠ A207), S213 (≠ A208), T218 (vs. gap), I239 (= I233), R241 (= R235), D265 (= D259), H289 (= H282), G291 (≠ A284)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
34% identity, 75% coverage: 67:303/316 of query aligns to 74:314/328 of Q9UBQ7
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
30% identity, 83% coverage: 45:305/316 of query aligns to 42:301/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V155), G147 (= G156), L148 (≠ M157), G149 (= G158), R150 (= R159), I151 (≠ V160), G152 (= G161), D170 (≠ T178), H201 (≠ A206), T202 (≠ A207), P203 (≠ A208)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
30% identity, 83% coverage: 45:305/316 of query aligns to 42:301/302 of 6rihA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
30% identity, 83% coverage: 45:305/316 of query aligns to 39:298/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G158), I148 (≠ V160), Y166 (= Y177), D167 (≠ T178), P168 (≠ D179), I169 (≠ L180), I170 (≠ Q181), H198 (≠ A206), T199 (≠ A207), L208 (= L215), R228 (= R235)
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
30% identity, 83% coverage: 45:305/316 of query aligns to 42:301/303 of 6plgA
7dkmA Phgdh covalently linked to oridonin (see paper)
30% identity, 83% coverage: 45:305/316 of query aligns to 43:302/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V76), A102 (≠ V104), G148 (= G156), R151 (= R159), I152 (≠ V160), Y170 (= Y177), D171 (≠ T178), P172 (≠ D179), I173 (≠ L180), H202 (≠ A206), T203 (≠ A207), P204 (≠ A208), T209 (≠ G212), C230 (≠ I233), A231 (= A234), R232 (= R235), H279 (= H282), G281 (≠ A284)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (= E296)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
Query Sequence
>PP_1707 FitnessBrowser__Putida:PP_1707
MKPEVLQLSPILIPQIRERLEQLFTVHRYYEQADKEAYVSQHAGNIRGVITGGHTGISQA
LMARLPNLEVIAVNGVGTDAVDLAYARDRGIQVTATIGALTEDVADLAIGLLIGLCRGIC
TGDRFVRAGRWATSTTPLAPLPLARQVSGMRVGIVGMGRVGRAVAQRAAAFGCPIRYTDL
QALDVPYGFEADLLQLAKDSDALILAAAADKGEALINRDVLQALGSEGYLINIARGKLVD
EPALIAALQAGEIGGAALDVFADEPRAPEALFEREDVVLQPHRASATVQTRTRMGEMVVA
SLVDVFAGRTPQGLVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory