SitesBLAST
Comparing PP_1770 FitnessBrowser__Putida:PP_1770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
57% identity, 58% coverage: 310:740/746 of query aligns to 1:431/440 of 3slhD
- active site: K23 (= K332), S24 (= S333), D50 (= D359), N95 (= N403), R125 (= R433), D317 (= D626), E345 (= E654), H388 (= H697), R389 (= R698), T415 (= T724)
- binding glyphosate: K23 (= K332), G97 (= G405), T98 (= T406), R125 (= R433), Q171 (= Q480), D317 (= D626), E345 (= E654), R348 (= R657), H388 (= H697), R389 (= R698)
- binding shikimate-3-phosphate: S24 (= S333), R28 (= R337), S169 (= S478), Q171 (= Q480), R196 (= R505), D317 (= D626), K344 (= K653)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S333), R28 (= R337), T98 (= T406), Q171 (= Q480), R196 (= R505), D317 (= D626), K344 (= K653)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
57% identity, 57% coverage: 314:740/746 of query aligns to 3:429/438 of Q83E11
- K21 (= K332) binding
- S22 (= S333) binding
- R26 (= R337) binding
- NSGT 93:96 (= NSGT 403:406) Phosphoenolpyruvate
- G95 (= G405) binding
- T96 (= T406) binding
- R123 (= R433) binding
- S167 (= S478) binding
- A168 (= A479) binding
- Q169 (= Q480) binding ; binding
- D315 (= D626) binding
- K342 (= K653) binding
- R346 (= R657) binding
- R387 (= R698) binding
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
57% identity, 58% coverage: 310:740/746 of query aligns to 1:427/434 of 4egrA
- active site: K23 (= K332), S24 (= S333), D50 (= D359), N95 (= N403), R125 (= R433), D313 (= D626), E341 (= E654), H384 (= H697), R385 (= R698), T411 (= T724)
- binding phosphoenolpyruvate: K23 (= K332), G97 (= G405), T98 (= T406), R125 (= R433), D313 (= D626), E341 (= E654), R344 (= R657), R385 (= R698)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
50% identity, 55% coverage: 322:730/746 of query aligns to 10:418/427 of Q9S400
- S21 (= S333) binding
- R25 (= R337) binding
- S166 (= S478) binding
- A167 (= A479) binding
- Q168 (= Q480) binding
- D312 (= D626) binding
- K339 (= K653) binding
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
50% identity, 55% coverage: 322:730/746 of query aligns to 10:418/427 of 1rf6A
- active site: K20 (= K332), S21 (= S333), D47 (= D359), N90 (= N403), D115 (≠ A428), R120 (= R433), D312 (= D626), E340 (= E654), H384 (= H697), R385 (= R698), T412 (= T724)
- binding glyphosate: K20 (= K332), G92 (= G405), T93 (= T406), R120 (= R433), Q168 (= Q480), D312 (= D626), E340 (= E654), R343 (= R657), H384 (= H697), R385 (= R698)
- binding shikimate-3-phosphate: S21 (= S333), R25 (= R337), S166 (= S478), Q168 (= Q480), R193 (= R505), I311 (= I625), D312 (= D626), K339 (= K653)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
50% identity, 55% coverage: 322:730/746 of query aligns to 10:418/427 of 1rf4A
- active site: K20 (= K332), S21 (= S333), D47 (= D359), N90 (= N403), D115 (≠ A428), R120 (= R433), D312 (= D626), E340 (= E654), H384 (= H697), R385 (= R698), T412 (= T724)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K332), S21 (= S333), R25 (= R337), G92 (= G405), T93 (= T406), R120 (= R433), S166 (= S478), A167 (= A479), Q168 (= Q480), R193 (= R505), D312 (= D626), K339 (= K653), E340 (= E654), R343 (= R657), H384 (= H697), R385 (= R698)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; CP4 EPSP synthase; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see paper)
49% identity, 56% coverage: 322:740/746 of query aligns to 18:447/455 of Q9R4E4
- S29 (= S333) binding
- R33 (= R337) binding
- A100 (≠ G405) mutation to G: Confers sensitivity to glyphosate allowing glyphosate to bind in its extended, inhibitory conformation.
- S173 (= S478) binding
- A174 (= A479) binding
- Q175 (= Q480) binding
- D326 (= D626) binding
- K353 (= K653) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
49% identity, 56% coverage: 322:740/746 of query aligns to 13:442/445 of 2pqcA
- active site: K23 (= K332), S24 (= S333), D50 (= D359), N93 (= N403), R123 (= R433), D321 (= D626), E349 (= E654), H399 (= H697), R400 (= R698), T426 (= T724)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K332), S24 (= S333), R28 (= R337), T96 (= T406), R123 (= R433), S168 (= S478), Q170 (= Q480), D321 (= D626), K348 (= K653), E349 (= E654), R352 (= R657), R400 (= R698)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
49% identity, 56% coverage: 322:740/746 of query aligns to 13:442/445 of 2pqbA
- active site: K23 (= K332), S24 (= S333), D50 (= D359), N93 (= N403), R123 (= R433), D321 (= D626), E349 (= E654), H399 (= H697), R400 (= R698), T426 (= T724)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K332), S24 (= S333), R28 (= R337), A95 (≠ G405), T96 (= T406), R123 (= R433), S168 (= S478), Q170 (= Q480), D321 (= D626), K348 (= K653), E349 (= E654), R352 (= R657), R400 (= R698)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
49% identity, 56% coverage: 322:740/746 of query aligns to 13:442/445 of 2ggaA
- active site: K23 (= K332), S24 (= S333), D50 (= D359), N93 (= N403), R123 (= R433), D321 (= D626), E349 (= E654), H399 (= H697), R400 (= R698), T426 (= T724)
- binding glyphosate: K23 (= K332), A94 (≠ S404), A95 (≠ G405), T96 (= T406), R123 (= R433), D321 (= D626), E349 (= E654), R352 (= R657), R400 (= R698)
- binding shikimate-3-phosphate: S24 (= S333), R28 (= R337), S168 (= S478), A169 (= A479), Q170 (= Q480), R195 (= R505), D321 (= D626), K348 (= K653)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
49% identity, 56% coverage: 322:740/746 of query aligns to 13:442/445 of 2gg6A
- active site: K23 (= K332), S24 (= S333), D50 (= D359), N93 (= N403), R123 (= R433), D321 (= D626), E349 (= E654), H399 (= H697), R400 (= R698), T426 (= T724)
- binding shikimate-3-phosphate: S24 (= S333), R28 (= R337), T96 (= T406), S168 (= S478), Q170 (= Q480), D321 (= D626), K348 (= K653)
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
39% identity, 39% coverage: 1:291/746 of query aligns to 1:290/293 of 3gggD
- binding nicotinamide-adenine-dinucleotide: V21 (≠ L21), G22 (= G22), F23 (≠ L23), M24 (≠ I24), D45 (= D45), I46 (≠ L46), S50 (= S50), S81 (≠ A80), S82 (≠ V81), P83 (= P82), V84 (≠ I83), T86 (≠ A85), Q107 (≠ V106), S109 (= S108), G134 (= G136), T135 (≠ S137)
- binding tyrosine: G225 (≠ A226), G226 (= G227)
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
40% identity, 37% coverage: 13:291/746 of query aligns to 5:282/285 of 3ggoA
- binding 3-(4-hydroxy-phenyl)pyruvic acid: G217 (≠ A226), G218 (= G227), G219 (= G228)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V13 (≠ L21), G14 (= G22), F15 (≠ L23), M16 (≠ I24), D37 (= D45), I38 (≠ L46), S42 (= S50), S73 (≠ A80), S74 (≠ V81), P75 (= P82), T78 (≠ A85), Q99 (≠ V106), S101 (= S108), A125 (= A135), G131 (= G141), M233 (= M242)
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
40% identity, 37% coverage: 13:291/746 of query aligns to 5:282/286 of 3ggpA
- binding hydroxyphenyl propionic acid: G218 (= G227), G219 (= G228)
- binding nicotinamide-adenine-dinucleotide: V13 (≠ L21), G14 (= G22), F15 (≠ L23), M16 (≠ I24), D37 (= D45), I38 (≠ L46), S42 (= S50), S73 (≠ A80), S74 (≠ V81), P75 (= P82), T78 (≠ A85), Q99 (≠ V106), S101 (= S108), G131 (= G141), M233 (= M242)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
44% identity, 37% coverage: 16:291/746 of query aligns to 7:283/293 of 4wjiA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G20), G13 (= G22), L14 (= L23), I15 (= I24), T36 (≠ D45), R37 (≠ L46), S38 (≠ D47), T41 (≠ S50), S71 (≠ A80), V72 (= V81), P73 (= P82), A76 (= A85), V97 (= V106), S99 (= S108), A125 (= A135), S130 (= S140), M234 (= M242)
- binding tyrosine: S99 (= S108), H122 (= H132), A125 (= A135), T127 (≠ S137), R226 (= R234)
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
36% identity, 37% coverage: 15:292/746 of query aligns to 11:288/373 of 5uyyA
Sites not aligning to the query:
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
36% identity, 37% coverage: 15:292/746 of query aligns to 3:280/365 of 6u60B
- binding nicotinamide-adenine-dinucleotide: G10 (= G22), L11 (= L23), I12 (= I24), D32 (= D45), I33 (≠ L46), A67 (= A80), P69 (= P82), E72 (≠ A85), V94 (= V106), S96 (= S108), G128 (= G141)
- binding tyrosine: K126 (≠ Q139)
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
36% identity, 37% coverage: 16:293/746 of query aligns to 9:284/286 of 3b1fA
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
29% identity, 56% coverage: 317:736/746 of query aligns to 7:424/426 of 3nvsA
- active site: K22 (= K332), S23 (= S333), D49 (= D359), N94 (= N403), P119 (≠ A428), R124 (= R433), H128 (≠ R437), Q135 (≠ E444), Y142 (≠ T451), E144 (≠ G452), A247 (= A548), A255 (≠ S556), D314 (= D626), E342 (= E654), H386 (= H697), R387 (= R698), K412 (≠ T724)
- binding glyphosate: K22 (= K332), G96 (= G405), R124 (= R433), Q172 (= Q480), D314 (= D626), E342 (= E654), R345 (= R657), H386 (= H697), R387 (= R698)
- binding magnesium ion: E123 (≠ K432), Q145 (≠ P453)
- binding shikimate-3-phosphate: K22 (= K332), S23 (= S333), R27 (= R337), T97 (= T406), S170 (= S478), S171 (≠ A479), Q172 (= Q480), S198 (≠ P501), Y201 (≠ T504), D314 (= D626), N337 (≠ E649), K341 (= K653)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S333), R27 (= R337), Q172 (= Q480), Y201 (≠ T504), D314 (= D626), K341 (= K653)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
29% identity, 56% coverage: 317:736/746 of query aligns to 7:424/426 of Q9KRB0
- K22 (= K332) binding
- S23 (= S333) binding
- R27 (= R337) binding
- S170 (= S478) binding
- S171 (≠ A479) binding
- S198 (≠ P501) binding
- D314 (= D626) binding
- N337 (≠ E649) binding
- K341 (= K653) binding
Query Sequence
>PP_1770 FitnessBrowser__Putida:PP_1770
MVNAAKTKPAPIIDRLVVVGLGLIGGSFAKGLRESGLCREVVGVDLDAPSRKQAVALGVV
DRCEEDLAAACVGADVIQLAVPILAMEKVLARLALLDLGDAIITDVGSAKGNVVREARAV
FGARLPRFVPGHPIAGSEQSGVEASNATLFRRHKVILTPLAETDPAALVLVDRLWRALDA
DVEHMSVERHDEVLAATSHLPHLLAFGLVDSLAKRNENLEIFRYAAGGFRDFTRIAGSDP
TMWHDIFLANRDAVLRTLDTFRSDLDALRDAIAEGDGHQLLGVFTRARVAREHFSKILAR
RAYVDAMNANDLIFQAQPGGRLNGRIRVPGDKSISHRSIMLGSLAEGTTEVEGFLEGEDA
LATLQAFRDMGVVIEGPNHGRVTIHGVGLHGLKPPPGPLYVGNSGTSMRLLSGLLAGQPF
DVTMTGDASLSKRPMNRVANPLREMGAVVETGPDGRPPLTIRGGHKLKGLTYTLPMASAQ
VKSCLLLAGLYAEGKTTVTEPAPTRDHTERMLRGFGYSVDSHGPVASLQSGGKLTATRIE
VPADISSAAFFLVAASIAEGSELVLEHVGINPTRTGVIDILRLMGGDITLENQREVGGEP
VADLRVRGAKLKGIDIPEALVPLAIDEFPVLFVAAACAEGRTVLRGAEELRVKESDRIQV
MADGLTTLGIKCEPTPDGIIIDGGQMGGGEVHGHGDHRIAMAFSVASLRASAPIRIHDCA
NVATSFPNFLALCAEVGIRVAEEGKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory