SitesBLAST
Comparing PP_1785 FitnessBrowser__Putida:PP_1785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
63% identity, 96% coverage: 2:354/366 of query aligns to 4:347/355 of P27830
- FI 12:13 (= FI 10:11) binding
- DKLT 33:36 (≠ DALT 31:34) binding
- DI 59:60 (≠ NI 57:58) binding
- T100 (= T98) binding
- D135 (= D133) active site, Proton donor
- E136 (= E134) active site, Proton acceptor
- Y160 (= Y158) active site, Proton acceptor
- YSASK 160:164 (= YSASK 158:162) binding
- N190 (= N188) binding
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
59% identity, 98% coverage: 2:361/366 of query aligns to 3:357/361 of 1kewA
- active site: T133 (= T132), D134 (= D133), E135 (= E134), L152 (vs. gap), L154 (≠ A145), F155 (= F146), T158 (= T149), Y167 (= Y158), K171 (= K162)
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), F11 (= F10), I12 (= I11), D32 (= D31), K33 (≠ A32), L34 (= L33), T35 (= T34), A37 (= A36), G38 (= G37), D58 (≠ N57), I59 (= I58), L80 (≠ F79), A81 (= A80), A82 (= A81), S84 (= S83), T99 (= T98), I131 (≠ V130), S132 (= S131), T133 (= T132), Y167 (= Y158), K171 (= K162), C194 (= C185), N196 (= N187), N197 (= N188)
- binding thymidine-5'-diphosphate: E135 (= E134), N196 (= N187), K206 (= K197), L207 (= L198), P222 (= P213), Y224 (= Y215), R231 (= R222), N266 (= N257), R297 (= R301), H300 (= H304), Y357 (= Y361)
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
59% identity, 98% coverage: 2:361/366 of query aligns to 3:357/361 of 1keuA
- active site: T133 (= T132), D134 (= D133), E135 (= E134), L152 (vs. gap), L154 (≠ A145), F155 (= F146), T158 (= T149), Y167 (= Y158), K171 (= K162)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (= S83), T133 (= T132), D134 (= D133), E135 (= E134), Y167 (= Y158), N196 (= N187), K206 (= K197), L207 (= L198), P222 (= P213), Y224 (= Y215), R231 (= R222), N266 (= N257), R297 (= R301), H300 (= H304), Y357 (= Y361)
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), F11 (= F10), I12 (= I11), D32 (= D31), K33 (≠ A32), L34 (= L33), T35 (= T34), G38 (= G37), D58 (≠ N57), L80 (≠ F79), A81 (= A80), A82 (= A81), S84 (= S83), T99 (= T98), S132 (= S131), T133 (= T132), Y167 (= Y158), K171 (= K162), C194 (= C185), N196 (= N187), N197 (= N188)
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
59% identity, 98% coverage: 2:361/366 of query aligns to 3:357/361 of P26391
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
61% identity, 96% coverage: 2:354/366 of query aligns to 4:341/344 of 1bxkB
- active site: S125 (≠ E123), T134 (= T132), D135 (= D133), E136 (= E134), S158 (= S156), Y160 (= Y158), S161 (= S159), K164 (= K162)
- binding nicotinamide-adenine-dinucleotide: G8 (= G6), G11 (= G9), F12 (= F10), I13 (= I11), D33 (= D31), K34 (≠ A32), L35 (= L33), T36 (= T34), A38 (= A36), G39 (= G37), D59 (≠ N57), I60 (= I58), L81 (≠ F79), A83 (= A81), T100 (= T98), I132 (≠ V130), S133 (= S131), T134 (= T132), K164 (= K162), C187 (= C185)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
53% identity, 98% coverage: 2:361/366 of query aligns to 6:360/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G6), G13 (= G9), F14 (= F10), I15 (= I11), D36 (= D31), A37 (= A32), L38 (= L33), T39 (= T34), G42 (= G37), D62 (≠ N57), I63 (= I58), L84 (≠ F79), A85 (= A80), A86 (= A81), T103 (= T98), S143 (= S131), T144 (= T132), Y169 (= Y158), K173 (= K162), C196 (= C185)
6bi4C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
47% identity, 94% coverage: 2:346/366 of query aligns to 4:308/311 of 6bi4C
- active site: T117 (= T132), D118 (= D133), E119 (= E134), Y142 (= Y158), K146 (= K162)
- binding beta-D-fructofuranose: Q62 (≠ C59), N63 (≠ D60), G64 (≠ A61), E65 (≠ A62)
- binding nicotinamide-adenine-dinucleotide: G8 (= G6), G11 (= G9), F12 (= F10), I13 (= I11), D34 (= D31), A35 (= A32), L36 (= L33), T37 (= T34), S39 (≠ A36), G40 (= G37), E60 (≠ N57), I61 (= I58), Q62 (≠ C59), F82 (= F79), A83 (= A80), A84 (= A81), T92 (= T98), V115 (= V130), T117 (= T132), Y142 (= Y158), K146 (= K162), C169 (= C185), S170 (= S186)
6bi4B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
47% identity, 94% coverage: 2:346/366 of query aligns to 4:307/310 of 6bi4B
- active site: T117 (= T132), D118 (= D133), E119 (= E134), Y142 (= Y158), K146 (= K162)
- binding alpha-D-glucopyranose: Q62 (≠ C59), N63 (≠ D60)
- binding nicotinamide-adenine-dinucleotide: G8 (= G6), G11 (= G9), F12 (= F10), I13 (= I11), D34 (= D31), A35 (= A32), L36 (= L33), T37 (= T34), S39 (≠ A36), G40 (= G37), E60 (≠ N57), F82 (= F79), A83 (= A80), A84 (= A81), T92 (= T98), S116 (= S131), T117 (= T132), Y142 (= Y158), K146 (= K162), C169 (= C185)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
46% identity, 95% coverage: 2:350/366 of query aligns to 4:318/329 of 2hunA
- active site: T125 (= T132), D126 (= D133), E127 (= E134), Y149 (= Y158), K153 (= K162)
- binding nicotinamide-adenine-dinucleotide: G8 (= G6), G11 (= G9), F12 (= F10), I13 (= I11), D34 (= D31), K35 (≠ A32), S40 (≠ G37), D60 (≠ N57), V61 (≠ I58), L80 (≠ F79), A81 (= A80), A82 (= A81), S99 (≠ T98), T125 (= T132), K153 (= K162), C176 (= C185), T177 (≠ S186), N178 (= N187), N179 (= N188)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
47% identity, 94% coverage: 2:344/366 of query aligns to 3:317/322 of 1r66A
- active site: T127 (= T132), D128 (= D133), E129 (= E134), Y151 (= Y158), K155 (= K162)
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), F11 (= F10), I12 (= I11), D37 (= D31), S38 (≠ A32), L39 (= L33), T40 (= T34), G43 (= G37), D63 (≠ N57), I64 (= I58), F83 (= F79), A84 (= A80), A85 (= A81), S87 (= S83), T102 (= T98), V125 (= V130), S126 (= S131), Y151 (= Y158), K155 (= K162), N181 (= N188)
- binding thymidine-5'-diphosphate: H88 (= H84), E129 (= E134), N180 (= N187), K190 (= K197), L191 (= L198), P206 (= P213), Y208 (= Y215), R215 (= R222), N250 (= N257), R274 (= R301), H277 (= H304)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
46% identity, 94% coverage: 2:344/366 of query aligns to 3:317/322 of 1r6dA
- active site: T127 (= T132), N128 (≠ D133), Q129 (≠ E134), Y151 (= Y158), K155 (= K162)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S83), H88 (= H84), T127 (= T132), N128 (≠ D133), Q129 (≠ E134), Y151 (= Y158), N180 (= N187), K190 (= K197), L191 (= L198), P206 (= P213), Y208 (= Y215), R215 (= R222), N250 (= N257), R274 (= R301), H277 (= H304), Y281 (= Y308)
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), F11 (= F10), I12 (= I11), D37 (= D31), S38 (≠ A32), L39 (= L33), T40 (= T34), A42 (= A36), G43 (= G37), D63 (≠ N57), I64 (= I58), F83 (= F79), A84 (= A80), A85 (= A81), S87 (= S83), T102 (= T98), V125 (= V130), S126 (= S131), Y151 (= Y158), K155 (= K162), N181 (= N188)
1ketA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound (see paper)
45% identity, 94% coverage: 2:346/366 of query aligns to 5:328/346 of 1ketA
- active site: T123 (= T132), D124 (= D133), E125 (= E134), Y159 (= Y158), K163 (= K162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G9), F13 (= F10), I14 (= I11), D35 (= D31), K36 (≠ A32), L37 (= L33), T38 (= T34), A40 (= A36), G41 (= G37), D60 (≠ N57), I61 (= I58), Y80 (≠ F79), A82 (= A81), S84 (= S83), T99 (= T98), S122 (= S131), T123 (= T132), Y159 (= Y158), K163 (= K162)
- binding thymidine-5'-diphosphate: E125 (= E134), N188 (= N187), F199 (≠ L198), R202 (≠ L201), Q203 (≠ M202), K214 (≠ P213), Y216 (= Y215), R223 (= R222), N258 (= N257), R282 (= R301), H285 (= H304)
1kepA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound (see paper)
45% identity, 94% coverage: 2:346/366 of query aligns to 5:328/346 of 1kepA
- active site: T123 (= T132), D124 (= D133), E125 (= E134), Y159 (= Y158), K163 (= K162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G9), F13 (= F10), I14 (= I11), D35 (= D31), K36 (≠ A32), L37 (= L33), T38 (= T34), G41 (= G37), D60 (≠ N57), I61 (= I58), Y80 (≠ F79), A81 (= A80), A82 (= A81), S84 (= S83), T99 (= T98), S122 (= S131), Y159 (= Y158), K163 (= K162), N189 (= N188)
- binding thymidine-5'-diphospho-beta-d-xylose: S84 (= S83), T123 (= T132), E125 (= E134), Y159 (= Y158), N188 (= N187), K198 (= K197), R223 (= R222), R282 (= R301)
1kerB The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound (see paper)
45% identity, 94% coverage: 2:346/366 of query aligns to 6:329/347 of 1kerB
- active site: T124 (= T132), D125 (= D133), E126 (= E134), Y160 (= Y158), K164 (= K162)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S85 (= S83), N87 (≠ V85), T124 (= T132), D125 (= D133), E126 (= E134), Y160 (= Y158), N189 (= N187), K199 (= K197), F200 (≠ L198), R203 (≠ L201), Q204 (≠ M202), K215 (≠ P213), L216 (≠ V214), Y217 (= Y215), R224 (= R222), N259 (= N257), R283 (= R301), H286 (= H304)
- binding nicotinamide-adenine-dinucleotide: G13 (= G9), F14 (= F10), I15 (= I11), D36 (= D31), K37 (≠ A32), L38 (= L33), T39 (= T34), G42 (= G37), D61 (≠ N57), I62 (= I58), Y81 (≠ F79), A82 (= A80), A83 (= A81), S85 (= S83), T100 (= T98), S123 (= S131), T124 (= T132), Y160 (= Y158), K164 (= K162), C187 (= C185), N190 (= N188)
P95780 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
44% identity, 94% coverage: 2:346/366 of query aligns to 7:330/348 of P95780
8sk0A Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
41% identity, 94% coverage: 2:344/366 of query aligns to 9:320/329 of 8sk0A
- binding nicotinamide-adenine-dinucleotide: G16 (= G9), F17 (= F10), I18 (= I11), D43 (= D31), S44 (≠ A32), L45 (= L33), T46 (= T34), G49 (= G37), D67 (≠ N57), F87 (= F79), A88 (= A80), A89 (= A81), T91 (≠ S83), T106 (= T98), V129 (= V130), S130 (= S131), T131 (= T132), Y155 (= Y158), K159 (= K162)
- binding thymidine-5'-diphosphate: E133 (= E134), N184 (= N187), K194 (= K197), V195 (≠ L198), P210 (= P213), Y212 (= Y215), R219 (= R222), N254 (= N257), R278 (= R301), H281 (= H304)
8sk0B Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
41% identity, 94% coverage: 2:344/366 of query aligns to 10:321/330 of 8sk0B
- binding nicotinamide-adenine-dinucleotide: G17 (= G9), F18 (= F10), I19 (= I11), D44 (= D31), S45 (≠ A32), L46 (= L33), T47 (= T34), G50 (= G37), D68 (≠ N57), I69 (= I58), F88 (= F79), A89 (= A80), A90 (= A81), T92 (≠ S83), T107 (= T98), V130 (= V130), Y156 (= Y158), K160 (= K162), G184 (≠ S186), N186 (= N188)
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
38% identity, 94% coverage: 2:344/366 of query aligns to 9:325/669 of Q9SYM5
- R283 (= R301) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
37% identity, 94% coverage: 2:344/366 of query aligns to 11:327/667 of Q9LPG6
- G18 (= G9) mutation to A: Abolishes dehydratase activity.
- K36 (≠ P26) mutation to A: Reduces dehydratase activity.
- D96 (= D86) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K162) mutation to A: Abolishes dehydratase activity.
- G193 (= G190) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
36% identity, 93% coverage: 2:342/366 of query aligns to 6:316/319 of 6vloA
- active site: T126 (= T132), D127 (= D133), E128 (= E134), Y151 (= Y158), K155 (= K162)
- binding nicotinamide-adenine-dinucleotide: G10 (= G6), G13 (= G9), F14 (= F10), I15 (= I11), D36 (≠ T34), I37 (≠ Y35), A42 (= A40), D59 (≠ N57), I60 (= I58), F81 (= F79), A82 (= A80), A83 (= A81), S85 (= S83), M124 (≠ V130), T126 (= T132), K155 (= K162)
- binding thymidine-5'-diphosphate: N180 (= N187), K190 (= K197), L191 (= L198), K194 (≠ L201), H206 (≠ P213), Q208 (≠ Y215), R215 (= R222), V250 (≠ N257), R275 (= R301), R281 (= R307)
Query Sequence
>PP_1785 FitnessBrowser__Putida:PP_1785
MILVTGGAGFIGSNFVLQWCAHNEEPVLNLDALTYAGNLANLQPLEGNPQHRFVQGNICD
AALLTKLFAEHRPRAVVHFAAESHVDRSITGPEAFVETNVMGTFRLLEAARAHWNSLEGA
EKEAFRFLHVSTDEVYGTLGPNDPAFTETTPYAPNSPYSASKAASDHLVRSYFHTYGMPV
LTTNCSNNYGPLHFPEKLIPLMIVNALAGKALPVYGDGQQIRDWLYVEDHCSGIRRVLEA
GAFGETYNIGGWNEKANIDIVRTLCSLLDEMAPAASRQVINQKTGEPVEQYAELIAYVTD
RPGHDRRYAIDARKIERELGWKPAETFETGIRKTVAWYLANQKWVKGVMDGSYRDWVAQQ
YGANKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory