SitesBLAST
Comparing PP_1791 FitnessBrowser__Putida:PP_1791 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q53WI0 4-hydroxy-2-oxovalerate aldolase; HOA; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-oxopentanoate aldolase; EC 4.1.3.39; EC 4.1.3.43 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
32% identity, 44% coverage: 4:240/534 of query aligns to 14:244/347 of Q53WI0
Sites not aligning to the query:
- 324 A→G: Increases the channeling efficiency of propanaldehyde from 57% to 94%.
8ih7A Amng-amnh complex
29% identity, 49% coverage: 5:268/534 of query aligns to 14:273/340 of 8ih7A
Sites not aligning to the query:
P9WMK5 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxopentanoate aldolase; 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.43; EC 4.1.3.39 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
25% identity, 44% coverage: 5:239/534 of query aligns to 11:240/346 of P9WMK5
- D16 (= D10) binding
- H198 (= H197) binding
- H200 (= H199) binding
Sites not aligning to the query:
- 322 G→F: Abolishes substrate channeling to HsaG.
4jn6C Crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37 (see paper)
25% identity, 44% coverage: 5:239/534 of query aligns to 8:237/339 of 4jn6C
- active site: D13 (= D10), H16 (≠ Y13), H195 (= H197), H197 (= H199)
- binding manganese (ii) ion: D13 (= D10), H195 (= H197), H197 (= H199)
- binding oxalate ion: R12 (= R9), M136 (= M140), V164 (≠ A168), S166 (= S170), H195 (= H197), H197 (= H199)
Sites not aligning to the query:
4lrsA Crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and coa accommodation whithin the shared cofactor-binding site
28% identity, 44% coverage: 5:240/534 of query aligns to 8:238/337 of 4lrsA
- active site: D13 (= D10), H16 (≠ Y13), H195 (= H197), H197 (= H199)
- binding magnesium ion: D13 (= D10), H195 (= H197), H197 (= H199)
- binding pyruvic acid: R12 (= R9), D13 (= D10), F134 (= F137), M136 (= M140), V164 (≠ A168), S166 (= S170), H195 (= H197), H197 (= H199)
Sites not aligning to the query:
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
23% identity, 43% coverage: 2:232/534 of query aligns to 4:223/347 of 3a9iA
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
23% identity, 43% coverage: 2:232/534 of query aligns to 5:224/314 of 2zyfA
P51016 4-hydroxy-2-oxovalerate aldolase; HOA; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxopentanoate aldolase; EC 4.1.3.39 from Pseudomonas sp. (strain CF600) (see 2 papers)
25% identity, 41% coverage: 5:224/534 of query aligns to 13:227/345 of P51016
- D18 (= D10) binding
- H200 (= H197) binding
- H202 (= H199) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1nvmA Crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate (see paper)
25% identity, 41% coverage: 5:224/534 of query aligns to 12:226/340 of 1nvmA
- active site: D17 (= D10), H20 (≠ Y13), H199 (= H197), H201 (= H199)
- binding manganese (ii) ion: D17 (= D10), H199 (= H197), H201 (= H199)
- binding oxalate ion: R16 (= R9), F138 (= F137), M140 (≠ L139), S170 (= S170), H199 (= H197), H201 (= H199)
Sites not aligning to the query:
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
23% identity, 43% coverage: 2:232/534 of query aligns to 5:222/312 of 2ztjA
P51015 4-hydroxy-2-oxovalerate aldolase 4; HOA 4; 4-hydroxy-2-keto-pentanoic acid aldolase 4; 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-oxopentanoate aldolase 4; EC 4.1.3.39; EC 4.1.3.43 from Paraburkholderia xenovorans (strain LB400) (see 3 papers)
27% identity, 41% coverage: 5:221/534 of query aligns to 12:223/346 of P51015
- R16 (= R9) mutation to A: Loss of aldol cleavage activity.; mutation to K: 4000-fold decrease in the catalytic efficiency of the aldol cleavage reaction.
- H20 (≠ Y13) mutation H->A,S: 100-fold decrease in the catalytic efficiency of the aldol cleavage reaction. Dramatic reduction in acetaldehyde and propanaldehyde channeling efficiency by more than 70%.
- L87 (= L93) mutation to A: 32-fold reduction in the catalytic efficiency with acetaldehyde as substrate of the aldol addition reaction, but no change in the catalytic efficiency using propanaldehyde; thus, exhibits a 40-fold preference for propanaldehyde over acetaldehyde.; mutation L->N,W: Loss of aldolase activity (with either enantiomer of HOPA), but retains some decarboxylase activity for the smaller oxaloacetate substrate. In the retro-aldol cleavage reaction, is inactive toward 4(S)-HOPA but is active toward 4(R)-HOPA, albeit with a great reduction in catalytic efficiency, and in the aldol addition reaction, produces also exclusively the 4(R)-enantiomer; when associated with F-290.
- L89 (≠ F97) mutation to A: As the wild-type enzyme, exhibits similar catalytic efficiency with acetaldehyde or propanaldehyde as substrate in the aldol addition reaction but displays higher catalytic efficiency with longer aldehydes (50-fold increase using pentaldehyde). Shows a reduction in aldehyde channeling efficiency by 30%.
Sites not aligning to the query:
- 290 Y→F: Loss of stereochemical control as the mutant is able to catalyze the aldol cleavage of substrates with both R and S configurations at C4 with similar kinetic parameters. 3.5-fold decrease in the catalytic efficiency of the aldol cleavage reaction. Reduction in aldehyde channeling efficiency by more than 30%. In the retro-aldol cleavage reaction, is inactive toward 4(S)-HOPA but is active toward 4(R)-HOPA, albeit with a great reduction in catalytic efficiency, and in the aldol addition reaction, produces also exclusively the 4(R)-enantiomer; when associated with N-87 or W-87.; Y→S: Loss of stereochemical control as the mutant is able to catalyze the aldol cleavage of substrates with both R and S configurations at C4 with similar kinetic parameters. 3.5-fold decrease in the catalytic efficiency of the aldol cleavage reaction.
- 322 G→A: Displays a reduction in aldehyde channeling efficiency of about 20%.; mutation G->F,L: Unable to channel either acetaldehyde or propanaldehyde.
- 323 G→A: Able to channel butyraldehyde (with less efficiency than wild-type) but not its isomer isobutyraldehyde.; G→F: Unable to channel either acetaldehyde or propanaldehyde.; G→L: Able to channel acetaldehyde but not the larger propanaldehyde.
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
23% identity, 43% coverage: 2:232/534 of query aligns to 5:230/376 of O87198
- R12 (= R9) binding
- E13 (≠ D10) binding
- H72 (≠ G75) binding ; mutation to L: Significant decrease in sensitivity to lysine inhibition. Large decrease in affinity for 2-oxoglutarate. Almost no effect on affinity for acetyl-CoA and on turnover number.
- D92 (≠ Q94) binding
- R133 (≠ G136) binding
- S135 (≠ N138) binding
- T166 (≠ S170) binding ; binding
- H195 (= H197) binding
- H197 (= H199) binding
Q8F3Q1 (R)-citramalate synthase CimA; LiCMS; EC 2.3.3.21 from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) (see 2 papers)
23% identity, 47% coverage: 4:253/534 of query aligns to 11:263/516 of Q8F3Q1
- R16 (= R9) mutation R->K,Q: Loss of activity.
- RD 16:17 (= RD 9:10) binding
- D17 (= D10) mutation to A: 34-fold increase in Km for pyruvate and 315-fold decrease in kcat.; mutation to N: 4.4-fold increase in Km for pyruvate and 480-fold decrease in kcat.
- L81 (≠ G75) mutation to A: 4.7-fold increase in Km for pyruvate and 15.7-fold decrease in kcat.; mutation to V: 3.3-fold increase in Km for pyruvate and 10.1-fold decrease in kcat.
- F83 (≠ M77) mutation to A: 5-fold increase in Km for acetyl-CoA and 120-fold decrease in kcat.
- L104 (= L96) mutation to V: 1.8-fold increase in Km for pyruvate and 3.4-fold decrease in kcat.
- Y144 (≠ W127) binding ; mutation to L: 259-fold increase in Km for pyruvate and 76-fold decrease in kcat.; mutation to V: 114-fold increase in Km for pyruvate and 5.3-fold decrease in kcat.
- E146 (≠ K129) mutation E->D,Q: Minor effects on the binding of acetyl-CoA, but causes a strong decrease in kcat.
- T179 (≠ S170) binding ; mutation to A: 16.4-fold increase in Km for pyruvate and 186-fold decrease in kcat.
Sites not aligning to the query:
- 302 mutation H->A,N: Loss of activity.
- 304 D→A: 5.2-fold increase in Km for acetyl-CoA and 16.6-fold decrease in kcat.
- 310 N→A: 2.2-fold increase in Km for acetyl-CoA and 1.7-fold decrease in kcat.
- 311 L→A: 8-fold increase in Km for acetyl-CoA and 6-fold decrease in kcat.
- 312 Y→A: Loss of activity.
- 430 Y→L: No change in Km for acetyl-CoA and 2.3-fold decrease in kcat. Severely impairs inhibition by isoleucine.
- 431 D→A: 1.8-fold decrease in Km for acetyl-CoA and 5-fold decrease in kcat.
- 451 L→V: 1.5-fold increase in Km for acetyl-CoA and 4.3 decrease in kcat.
- 454 Y→A: 1.4 decrease in Km for acetyl-CoA and 17-fold decrease in kcat. Still inhibited by isoleucine and weakly inhibited by leucine.
- 458 I→A: 1.3-fold decrease in Km for acetyl-CoA and 14-fold decrease in kcat. Abolishes inhibition by isoleucine.
- 464 T→A: 1.8-fold decrease in Km for acetyl-CoA and 4.3-fold decrease in kcat.
- 468 V→A: No change in Km for acetyl-CoA and 2-fold decrease in kcat. Increases inhibition by isoleucine and leucine becomes an effective inhibitor.
- 493 P→A: 1.5-fold decrease in Km for acetyl-CoA and 2.6-fold decrease in kcat.
- 495 Q→A: 1.6-fold decrease in Km for acetyl-CoA and 2.8-fold decrease in kcat.
3bliA Crystal structure of the catalytic domain of licms in complexed with pyruvate and acetyl-coa (see paper)
23% identity, 47% coverage: 4:253/534 of query aligns to 5:257/311 of 3bliA
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 21% coverage: 135:246/534 of query aligns to 221:341/506 of Q9FG67
- A290 (≠ G195) mutation to T: In gsm1-2; loss of conversion of C3 to C4 glucosinolates.
Sites not aligning to the query:
- 102 S→F: In gsm1-1; loss of conversion of C3 to C4 glucosinolates.
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 15% coverage: 167:246/534 of query aligns to 258:341/503 of Q9FN52
- G263 (= G172) mutation to E: In gsm2-1; loss of activity and lack of C6, C7 and C8 aliphatic glucosinolates.
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
35% identity, 14% coverage: 165:239/534 of query aligns to 245:326/370 of Q8TB92
- H278 (= H197) mutation to R: Abolishes catalytic activity.
Sites not aligning to the query:
- 2 modified: N-myristoyl glycine; G→A: Abolishes myristoylation and induces a subcellular location change.
- 86 R→Q: Abolishes catalytic activity.
- 237 L→S: Abolishes catalytic activity.
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
37% identity, 14% coverage: 165:239/534 of query aligns to 173:254/296 of 3mp5B
Sites not aligning to the query:
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
37% identity, 14% coverage: 165:239/534 of query aligns to 173:254/296 of 3mp3B
- binding (3R,5S,9R,21S)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9,21-tetrahydroxy-8,8-dimethyl-10,14,19-trioxo-2,4,6-trioxa-18-thia-11,15-diaza-3,5-diphosphatricosan-23-oic acid 3,5-dioxide: T178 (≠ S170), H206 (= H197)
- binding magnesium ion: H206 (= H197), H208 (= H199)
Sites not aligning to the query:
- binding (3R,5S,9R,21S)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9,21-tetrahydroxy-8,8-dimethyl-10,14,19-trioxo-2,4,6-trioxa-18-thia-11,15-diaza-3,5-diphosphatricosan-23-oic acid 3,5-dioxide: 14, 15, 18, 49, 50, 51, 54, 81, 82, 84, 85, 111, 122, 140, 142
- binding magnesium ion: 15
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
37% identity, 14% coverage: 165:239/534 of query aligns to 173:254/296 of 2cw6A
Sites not aligning to the query:
Query Sequence
>PP_1791 FitnessBrowser__Putida:PP_1791
MKHLDCTLRDGGYYNNWNFSEALIAQYITAMQAAGIQTIELGLRSLKNSSFSGACAYTTD
AFLSTLDLPPSMTIGVMVNGSELVGKNAGQQALQLLFPSPASESPVDLVRIACHVHEFAE
ALPAASWLKERGYDVGFNLMQIANCSESEIKALAKLANNYPLDVLYFADSMGSMSPDDAA
QIIQWLRSEWQGALGIHTHDNLGLALSNTLRAMDEGVTWVDSTVTGMGRGPGNARTEELA
IEIAARTRKPANLIPLMTLLREHFKPMQVKYGWGTNPYYYLAGKYGIHPTYIQEMLGDSR
FGEEDILAVIEYLRNEGGKKFSVHTLDAARHFYRGAPTGQWAPQDLLAGQDVLLLGTGPG
VAAHRQALEHFIRQHKPVVMALNTQSSIAAELIDVRVACHPVRLLADCEAHIELPQPLIT
PYSMLPMDVQGALANKNVLDFGLNVQPDKFTFEDTHCTIPTSLVVAYAMAAASSGKAKRI
LMAGFDGYPGEDPRNADTNKLFRQYQDTQSSTPLLCLTPTRYDISCQSVYGPLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory