SitesBLAST
Comparing PP_1803 FitnessBrowser__Putida:PP_1803 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
26% identity, 97% coverage: 5:317/323 of query aligns to 2:304/309 of 4zrnA
- active site: T117 (≠ S119), G119 (vs. gap), A120 (≠ K121), Y143 (= Y145), K147 (= K149), Y181 (vs. gap), G185 (= G179)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (≠ A34), N32 (≠ S35), S34 (≠ D37), S35 (≠ L38), G36 (= G39), S51 (≠ T50), I52 (≠ V51), L73 (≠ A73), A74 (= A74), A75 (= A75), T92 (≠ V94), S115 (≠ I117), S116 (= S118), Y143 (= Y145), K147 (= K149), Y170 (≠ P172), V173 (= V175)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S119), G119 (vs. gap), A120 (≠ K121), Y143 (= Y145), N172 (≠ L174), G185 (= G179), V186 (= V180), H201 (≠ G194), F203 (= F199), Y208 (≠ N204), R210 (= R206), V244 (≠ L242), R267 (vs. gap), D270 (≠ L266)
Q9FX01 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1; At3BETAHSD/D1; 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-1; Reticulon-like protein B24; AtRTNLB24; Sterol-4-alpha-carboxylate 3-dehydrogenase 1, decarboxylating; EC 1.1.1.418 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 98% coverage: 3:317/323 of query aligns to 9:358/439 of Q9FX01
- D41 (vs. gap) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- D72 (= D53) Essential for the 3betaHSD/D activity; mutation D->A,V: Lost activity.
- T131 (≠ I117) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- S133 (= S119) mutation to A: Reduced activity with slower catalysis and lower substrate binding.
- S135 (≠ K121) mutation to A: Normal activity, but slower catalysis with 4alpha-carboxysterol as substrate.; mutation to T: Altered activity due to reduced affinity and catalysis and leading to lower amount of C4-demethylated sterols and higher quantities of 4,4-dimethylated sterol intermediates, and a higher ratio of 4,4-dimethylsterols to 4alpha-methylsterols.; mutation to Y: Altered activity leading to an exclusive production of C4-methylated sterols and 4alpha-carboxy-3beta-hydroxy sterols.
- Y161 (= Y145) Essential for the 3betaHSD/D activity; mutation to F: Lost activity.
- K165 (= K149) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
- R320 (vs. gap) mutation to I: Normal activity.
- R328 (vs. gap) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
30% identity, 78% coverage: 6:256/323 of query aligns to 4:262/308 of 6wj9B
- active site: A119 (≠ S119), A120 (≠ I120), A121 (≠ K121), F144 (≠ Y145), K148 (= K149)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), I13 (≠ V15), D32 (≠ S35), D33 (= D37), S35 (≠ G39), T36 (≠ G40), G37 (≠ A41), D55 (= D53), A56 (≠ L54), L75 (≠ A73), A76 (= A74), A77 (= A75), S94 (≠ V94), A117 (≠ I117), A119 (≠ S119), F144 (≠ Y145), K148 (= K149), F171 (≠ P172), F172 (≠ V173), I174 (≠ V175)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ M80), N173 (≠ L174), G187 (= G179), V188 (= V180), F192 (= F184), T203 (≠ P198), L204 (vs. gap), F205 (= F199), R212 (= R206), L248 (= L242)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
30% identity, 78% coverage: 6:256/323 of query aligns to 3:261/307 of 6wjaA
- active site: A118 (≠ S119), A119 (≠ I120), A120 (≠ K121), F143 (≠ Y145), K147 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (≠ S35), D32 (= D37), S34 (≠ G39), T35 (≠ G40), G36 (≠ A41), A55 (≠ L54), L74 (≠ A73), A75 (= A74), A76 (= A75), S93 (≠ V94), F143 (≠ Y145), K147 (= K149), F170 (≠ P172), F171 (≠ V173), I173 (≠ V175)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ M80), A120 (≠ K121), N172 (≠ L174), G186 (= G179), V187 (= V180), F191 (= F184), T202 (≠ P198), F204 (= F199), R211 (= R206), L247 (= L242)
Sites not aligning to the query:
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
36% identity, 51% coverage: 6:171/323 of query aligns to 2:158/321 of 4id9A
- active site: S106 (= S119), Y132 (= Y145), K136 (= K149)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), R10 (≠ F14), V11 (= V15), D30 (≠ A30), L31 (≠ I31), R32 (= R32), S44 (≠ T50), L45 (≠ V51), L64 (≠ A73), A66 (= A75), V81 (= V94), S106 (= S119), Y132 (= Y145), K136 (= K149)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
36% identity, 51% coverage: 6:171/323 of query aligns to 3:159/328 of 4id9B
- active site: S107 (= S119), Y133 (= Y145), K137 (= K149)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), R11 (≠ F14), V12 (= V15), D31 (≠ A30), L32 (≠ I31), S45 (≠ T50), L46 (≠ V51), L65 (≠ A73), A67 (= A75), V82 (= V94), Y133 (= Y145), K137 (= K149)
Sites not aligning to the query:
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
25% identity, 65% coverage: 6:215/323 of query aligns to 3:222/314 of 6zldA
- active site: T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), Y149 (= Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (≠ S35), H33 (≠ R36), F34 (≠ D37), I35 (≠ L38), K43 (≠ S42), D62 (≠ L54), I63 (≠ S55), L81 (≠ A73), A82 (= A74), A83 (= A75), I124 (= I117), T126 (≠ S119), K153 (= K149), Y176 (≠ P172), T178 (≠ L174), R185 (≠ K181), M188 (vs. gap)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ V77), R88 (≠ M80), T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), Y149 (= Y145), F177 (≠ V173), T178 (≠ L174), R185 (≠ K181), M188 (vs. gap), A189 (vs. gap), R192 (≠ S186), T204 (≠ P198), F206 (= F199), Q211 (≠ N204), R213 (= R206)
Sites not aligning to the query:
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
25% identity, 65% coverage: 6:215/323 of query aligns to 3:222/314 of 6zl6A
- active site: T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), Y149 (= Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (≠ S35), H33 (≠ R36), F34 (≠ D37), I35 (≠ L38), K43 (≠ S42), D62 (≠ L54), I63 (≠ S55), L81 (≠ A73), A82 (= A74), A83 (= A75), I124 (= I117), T126 (≠ S119), K153 (= K149), Y176 (≠ P172), T178 (≠ L174), V179 (= V175), R185 (≠ K181), M188 (vs. gap)
- binding uridine-5'-diphosphate: T178 (≠ L174), A189 (vs. gap), R192 (≠ S186), T204 (≠ P198), F206 (= F199), Q211 (≠ N204), R213 (= R206)
Sites not aligning to the query:
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
25% identity, 65% coverage: 6:215/323 of query aligns to 3:222/321 of 6zllA
- active site: T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), Y149 (= Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (≠ S35), H33 (≠ R36), F34 (≠ D37), I35 (≠ L38), K43 (≠ S42), D62 (≠ L54), I63 (≠ S55), L81 (≠ A73), A82 (= A74), A83 (= A75), I124 (= I117), T126 (≠ S119), Y149 (= Y145), K153 (= K149), Y176 (≠ P172), V179 (= V175), R185 (≠ K181), M188 (vs. gap)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ V77), V87 (= V79), R88 (≠ M80), T126 (≠ S119), S127 (≠ I120), Y149 (= Y145), T178 (≠ L174), R185 (≠ K181), A189 (vs. gap), R192 (≠ S186), T204 (≠ P198), F206 (= F199), Q211 (≠ N204), R213 (= R206)
Sites not aligning to the query:
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: 250, 276
8fenA Panicum vigratum dihydroflavonol 4-reductase complexed with NADP and dhq (see paper)
29% identity, 75% coverage: 6:247/323 of query aligns to 7:267/326 of 8fenA
- binding (2r,3r)-2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-2,3-dihydro-4h-chromen-4-one: T127 (≠ S119), A128 (≠ I120), G129 (vs. gap), N132 (= N123), Y162 (= Y145), L191 (= L174), Q226 (≠ S207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), F15 (= F14), V16 (= V15), R36 (= R36), K43 (vs. gap), D63 (= D53), L64 (= L54), V83 (≠ A73), A84 (= A74), T85 (≠ A75), T125 (≠ I117), S126 (= S118), T127 (≠ S119), Y162 (= Y145), K166 (= K149), P189 (= P172), P190 (≠ V173), V192 (= V175), S204 (≠ W190)
8femA Panicum vigratum dihydroflavonol 4-reductase complexed with NADP (see paper)
29% identity, 75% coverage: 6:247/323 of query aligns to 7:267/327 of 8femA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), F15 (= F14), V16 (= V15), R36 (= R36), K43 (vs. gap), D63 (= D53), L64 (= L54), V83 (≠ A73), A84 (= A74), T85 (≠ A75), T125 (≠ I117), S126 (= S118), T127 (≠ S119), Y162 (= Y145), K166 (= K149), P189 (= P172), P190 (≠ V173), V192 (= V175), S204 (≠ W190)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
25% identity, 65% coverage: 6:215/323 of query aligns to 3:222/314 of 6zljA
- active site: T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), F149 (≠ Y145), K153 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D32 (≠ S35), H33 (≠ R36), F34 (≠ D37), I35 (≠ L38), K43 (≠ S42), D62 (≠ L54), I63 (≠ S55), L81 (≠ A73), A82 (= A74), A83 (= A75), I124 (= I117), T126 (≠ S119), K153 (= K149), Y176 (≠ P172), T178 (≠ L174), V179 (= V175), R185 (≠ K181), M188 (vs. gap)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ V77), R88 (≠ M80), T126 (≠ S119), S127 (≠ I120), S128 (≠ K121), F149 (≠ Y145), F177 (≠ V173), T178 (≠ L174), R185 (≠ K181), M188 (vs. gap), A189 (vs. gap), R192 (≠ S186), T204 (≠ P198), F206 (= F199), Q211 (≠ N204), R213 (= R206)
Sites not aligning to the query:
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: 250, 276
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
26% identity, 94% coverage: 6:310/323 of query aligns to 3:302/313 of 6bwlA
- active site: T122 (≠ S119), C123 (≠ I120), M124 (≠ K121), Y147 (= Y145), K151 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (≠ G27), N32 (≠ S28), L33 (≠ F29), N35 (≠ I31), S36 (≠ R32), D57 (= D53), I58 (≠ L54), L79 (≠ A73), A80 (= A74), A81 (= A75), I83 (≠ V77), M120 (≠ I117), K151 (= K149), N176 (≠ L174), T177 (≠ V175)
- binding uridine-5'-diphosphate: N176 (≠ L174), G189 (= G179), V190 (= V180), N205 (≠ P198), I206 (vs. gap), Y207 (≠ F199), Q212 (≠ N204), R214 (= R206), I250 (≠ L242), E275 (≠ L279)
6x3bB Structure of rmd from pseudomonas aeruginosa complexed with NADPH
32% identity, 55% coverage: 6:184/323 of query aligns to 4:169/297 of 6x3bB
- active site: S104 (= S119), G105 (≠ I120), D106 (≠ K121), Y130 (= Y145), K134 (= K149)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), S10 (= S12), G11 (= G13), F12 (= F14), V13 (= V15), D38 (= D37), L39 (= L38), L59 (≠ A73), A60 (= A74), G61 (≠ A75), T63 (≠ V77), I102 (= I117), Y130 (= Y145), K134 (= K149), H160 (≠ V175), Q165 (≠ V180)
- binding pyrophosphate 2-: D106 (≠ K121)
Sites not aligning to the query:
6x3bA Structure of rmd from pseudomonas aeruginosa complexed with NADPH
32% identity, 55% coverage: 6:184/323 of query aligns to 8:173/300 of 6x3bA
- active site: S108 (= S119), G109 (≠ I120), D110 (≠ K121), Y134 (= Y145), K138 (= K149)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (= S12), G15 (= G13), F16 (= F14), V17 (= V15), D42 (= D37), L43 (= L38), L63 (≠ A73), A64 (= A74), G65 (≠ A75), T67 (≠ V77), Y134 (= Y145), K138 (= K149), H164 (≠ V175), Q169 (≠ V180)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
26% identity, 55% coverage: 1:178/323 of query aligns to 1:177/310 of 6dntA
- active site: S120 (= S119), S121 (≠ I120), A122 (≠ K121), Y144 (= Y145), K148 (= K149)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ V77), S120 (= S119), S121 (≠ I120), Y144 (= Y145), F172 (≠ V173), N173 (≠ L174)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G13 (= G13), F14 (= F14), I15 (≠ V15), D33 (vs. gap), N34 (≠ R32), L35 (≠ A33), S36 (≠ A34), S37 (= S35), G38 (≠ R36), D57 (= D53), L58 (= L54), L76 (≠ A73), A77 (= A74), A78 (= A75), A80 (≠ V77), S118 (≠ I117), S119 (= S118), Y144 (= Y145), K148 (= K149), Y171 (≠ P172), V174 (= V175)
Sites not aligning to the query:
- active site: 187
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: 187, 188, 191, 203, 204, 205, 210, 212, 246, 269, 272
- binding zinc ion: 209, 275
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
29% identity, 54% coverage: 6:178/323 of query aligns to 3:184/322 of 1r6dA
- active site: T127 (≠ S119), N128 (≠ I120), Q129 (≠ K121), Y151 (= Y145), K155 (= K149)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ V77), H88 (= H78), T127 (≠ S119), N128 (≠ I120), Q129 (≠ K121), Y151 (= Y145), N180 (≠ L174)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), F11 (= F14), I12 (≠ V15), D37 (≠ Q47), S38 (≠ A48), L39 (≠ V49), T40 (= T50), A42 (= A52), G43 (vs. gap), D63 (= D53), I64 (≠ L54), F83 (≠ A73), A84 (= A74), A85 (= A75), S87 (≠ V77), T102 (≠ V94), V125 (≠ I117), S126 (= S118), Y151 (= Y145), K155 (= K149), N181 (≠ V175)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
29% identity, 54% coverage: 6:178/323 of query aligns to 3:184/322 of 1r66A
- active site: T127 (≠ S119), D128 (≠ I120), E129 (≠ K121), Y151 (= Y145), K155 (= K149)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), F11 (= F14), I12 (≠ V15), D37 (≠ Q47), S38 (≠ A48), L39 (≠ V49), T40 (= T50), G43 (vs. gap), D63 (= D53), I64 (≠ L54), F83 (≠ A73), A84 (= A74), A85 (= A75), S87 (≠ V77), T102 (≠ V94), V125 (≠ I117), S126 (= S118), Y151 (= Y145), K155 (= K149), N181 (≠ V175)
- binding thymidine-5'-diphosphate: H88 (= H78), E129 (≠ K121), N180 (≠ L174)
Sites not aligning to the query:
3bxxA Binding of two substrate analogue molecules to dihydroflavonol 4-reductase alters the functional geometry of the catalytic site (see paper)
29% identity, 56% coverage: 4:183/323 of query aligns to 1:196/324 of 3bxxA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S9 (= S12), G10 (= G13), F11 (= F14), I12 (≠ V15), R32 (= R36), K39 (≠ G45), D59 (= D53), L60 (= L54), V79 (≠ A73), T81 (≠ A75), P82 (≠ R76), P185 (= P172), L187 (= L174), V188 (= V175)
- binding 3,5,7,3',4'-pentahydroxyflavone: S123 (= S119), G125 (vs. gap), Y158 (= Y145), F159 (≠ G146)
Sites not aligning to the query:
2nnlD Binding of two substrate analogue molecules to dihydroflavonol-4- reductase alters the functional geometry of the catalytic site
29% identity, 56% coverage: 4:183/323 of query aligns to 1:196/324 of 2nnlD
- binding (2s)-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-2,3-dihydro-4h-chromen-4-one: F85 (≠ E82), A124 (≠ I120), N128 (= N123), Y158 (= Y145), L187 (= L174)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S9 (= S12), G10 (= G13), F11 (= F14), I12 (≠ V15), R32 (= R36), K39 (≠ G45), D59 (= D53), L60 (= L54), V79 (≠ A73), A80 (= A74), T81 (≠ A75), T121 (≠ I117), Y158 (= Y145), K162 (= K149), P185 (= P172), T186 (≠ V173), V188 (= V175)
Sites not aligning to the query:
Query Sequence
>PP_1803 FitnessBrowser__Putida:PP_1803
MERRTILVTGASGFVGGALCRQLATLGSFAIRAASRDLGGASVAGIQAVTVADLSATTDW
ARALSGVDLVVHAAARVHVMKETASDSLAEFRRVNVDGTLNLARQAAAAGVRRFIFISSI
KVNGESSQPGQPLRADDSPAPQDAYGVSKHEAEQGLRQLAAATGMEVVVIRPVLVYGPGV
KANFHSMMRWLQRGVPLPFGAVCNRRSLVSLANLVDLVVTCIDHPRAANQTFLASDGDDV
SLTQLLRALGLALGRPARLLPVPAGLLRGAVLLIGRRDLAQRLFGTLQVDIEKNRQLLGW
YPPCTLEQGLNMTARSFLGARRP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory