SitesBLAST
Comparing PP_1951 FitnessBrowser__Putida:PP_1951 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
35% identity, 97% coverage: 3:269/275 of query aligns to 2:251/258 of 4wecA
- active site: G21 (= G22), S143 (= S162), Q154 (≠ G173), Y157 (= Y176), K161 (= K180)
- binding nicotinamide-adenine-dinucleotide: G17 (= G18), A19 (= A20), S20 (= S21), G21 (= G22), I22 (≠ L23), D41 (= D42), I42 (≠ L43), V61 (= V62), D62 (= D68), V63 (= V69), N89 (= N95), T141 (= T160), Y157 (= Y176), K161 (= K180), P187 (= P206), P189 (= P208), V190 (≠ F209)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
33% identity, 96% coverage: 7:269/275 of query aligns to 12:258/261 of 5u9pB
- active site: G27 (= G22), S152 (= S162), Y165 (= Y176), K169 (= K180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G18), R26 (≠ S21), G27 (= G22), I28 (≠ L23), R48 (≠ L43), D73 (= D68), V74 (= V69), N100 (= N95), A101 (= A96), I150 (≠ T160), Y165 (= Y176), K169 (= K180), P195 (= P206), F198 (= F209), T200 (= T211), L202 (≠ I213), N203 (≠ G214)
7vyqA Short chain dehydrogenase (scr) cryoem structure with NADP and ethyl 4-chloroacetoacetate (see paper)
33% identity, 96% coverage: 6:270/275 of query aligns to 30:279/280 of 7vyqA
- binding ethyl 4-chloranyl-3-oxidanylidene-butanoate: T123 (≠ D99), S173 (= S162), Q183 (≠ T171), Y219 (≠ P208), F227 (≠ M218), W236 (≠ M227)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G42 (= G18), S44 (≠ A20), G45 (≠ S21), G46 (= G22), I47 (≠ L23), N67 (= N44), H69 (≠ E46), I93 (≠ V69), N119 (= N95), A120 (= A96), G121 (= G97), V144 (= V133), S173 (= S162), Y188 (= Y176), K192 (= K180), P217 (= P206), G218 (= G207), I220 (≠ F209), T222 (= T211), I224 (= I213), T225 (≠ G214)
7dlmA Short chain dehydrogenase (scr) crystal structure with NADPH (see paper)
33% identity, 96% coverage: 6:270/275 of query aligns to 30:279/280 of 7dlmA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G42 (= G18), S44 (≠ A20), G45 (≠ S21), G46 (= G22), I47 (≠ L23), Y66 (≠ L43), N67 (= N44), S68 (≠ R45), H69 (≠ E46), C91 (≠ L67), N92 (≠ D68), I93 (≠ V69), N119 (= N95), A120 (= A96), G121 (= G97), V122 (≠ I98), T171 (= T160), S173 (= S162), Y188 (= Y176), K192 (= K180), P217 (= P206), G218 (= G207), I220 (≠ F209), T222 (= T211), I224 (= I213)
A7DY56 Tropinone reductase; EC 1.1.1.206; EC 1.1.1.236 from Cochlearia officinalis (Common scurvygrass) (see paper)
30% identity, 96% coverage: 7:271/275 of query aligns to 14:263/273 of A7DY56
- Y209 (≠ F217) mutation to S: Loss of tropinone or nortropinone reduction, but faster reduction of cyclohexanones.
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 96% coverage: 6:269/275 of query aligns to 1:250/252 of 1vl8B
- active site: G17 (= G22), S143 (= S162), I154 (≠ G173), Y157 (= Y176), K161 (= K180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G18), R16 (≠ S21), G17 (= G22), L18 (= L23), S37 (≠ D42), R38 (≠ L43), C63 (≠ L67), D64 (= D68), V65 (= V69), A91 (≠ N95), A92 (= A96), G93 (= G97), I94 (= I98), V114 (= V133), I141 (≠ T160), S143 (= S162), Y157 (= Y176), K161 (= K180), P187 (= P206), G188 (= G207), Y190 (≠ F209), T192 (= T211), M194 (≠ I213), T195 (≠ G214)
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
32% identity, 94% coverage: 10:267/275 of query aligns to 4:260/260 of 1zemA
- active site: N16 (≠ G22), S142 (= S162), Y155 (= Y176), K159 (= K180), D212 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), G15 (≠ S21), N16 (≠ G22), I17 (≠ L23), D36 (= D42), M37 (≠ L43), D62 (= D68), V63 (= V69), N89 (= N95), A90 (= A96), G91 (= G97), T140 (= T160), S142 (= S162), Y155 (= Y176), K159 (= K180), P185 (= P206), M188 (≠ I213)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
36% identity, 98% coverage: 1:270/275 of query aligns to 1:253/254 of 3lqfA
- active site: G22 (= G22), S144 (= S162), Y159 (= Y176), K163 (= K180)
- binding meso-erythritol: N151 (vs. gap), Y159 (= Y176), Y191 (≠ P208), T197 (≠ G214), M200 (≠ F217)
- binding nicotinamide-adenine-dinucleotide: G18 (= G18), S21 (= S21), G22 (= G22), I23 (≠ L23), D42 (= D42), R43 (≠ L43), D66 (= D68), V67 (= V69), S92 (≠ A109), L142 (≠ T160), S144 (= S162), K163 (= K180), P189 (= P206), V192 (≠ F209), T194 (= T211), M196 (≠ I213), T197 (≠ G214)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
36% identity, 98% coverage: 1:270/275 of query aligns to 1:253/254 of 2wsbA
- active site: G22 (= G22), S144 (= S162), Y159 (= Y176), K163 (= K180)
- binding nicotinamide-adenine-dinucleotide: G18 (= G18), S21 (= S21), G22 (= G22), I23 (≠ L23), D42 (= D42), R43 (≠ L43), D66 (= D68), V67 (= V69), S92 (≠ A109), A93 (= A110), L142 (≠ T160), S144 (= S162), Y159 (= Y176), K163 (= K180), P189 (= P206), V192 (≠ F209), T194 (= T211), M196 (≠ I213), T197 (≠ G214)
- binding n-propanol: S144 (= S162), M145 (≠ V163), N151 (vs. gap), N151 (vs. gap), Y159 (= Y176), Y159 (= Y176), Y191 (≠ P208)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
36% identity, 98% coverage: 1:270/275 of query aligns to 1:253/254 of 2wdzA
- active site: G22 (= G22), S144 (= S162), Y159 (= Y176), K163 (= K180)
- binding (2S)-pentane-1,2-diol: A45 (≠ R45), D49 (= D49), R62 (≠ H65), S146 (= S164), Y159 (= Y176)
- binding nicotinamide-adenine-dinucleotide: G18 (= G18), S21 (= S21), G22 (= G22), I23 (≠ L23), D42 (= D42), R43 (≠ L43), A65 (vs. gap), D66 (= D68), V67 (= V69), S92 (≠ A109), A93 (= A110), L142 (≠ T160), S144 (= S162), Y159 (= Y176), K163 (= K180), P189 (= P206), V192 (≠ F209), T194 (= T211), M196 (≠ I213), T197 (≠ G214)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
36% identity, 98% coverage: 1:270/275 of query aligns to 1:253/254 of C0KTJ6
Sites not aligning to the query:
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
31% identity, 93% coverage: 15:269/275 of query aligns to 9:246/248 of 6ixmC
- active site: G16 (= G22), S142 (= S162), Y155 (= Y176), K159 (= K180)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S15 (= S21), G16 (= G22), I17 (≠ L23), D36 (= D42), I37 (≠ L43), A61 (≠ L67), D62 (= D68), T63 (≠ V69), N89 (= N95), A90 (= A96), M140 (≠ T160), S142 (= S162), Y155 (= Y176), K159 (= K180), P185 (= P206), A186 (≠ G207), Y187 (≠ P208), I188 (≠ F209), L192 (≠ I213)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
31% identity, 95% coverage: 9:269/275 of query aligns to 4:258/260 of 6zzqA
- active site: G17 (= G22), S142 (= S162), Y155 (= Y176)
- binding acetoacetic acid: Q94 (≠ E114), S142 (= S162), K152 (vs. gap), Y155 (= Y176), Q196 (≠ F217)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), S16 (= S21), G17 (= G22), I18 (≠ L23), D37 (= D42), M38 (≠ L43), D63 (= D68), V64 (= V69), N90 (= N95), A91 (= A96), G92 (= G97), M140 (≠ T160), A141 (≠ T161), S142 (= S162), Y155 (= Y176), K159 (= K180), Y187 (≠ P208), V188 (≠ F209), T190 (= T211)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 93% coverage: 15:270/275 of query aligns to 11:244/244 of 4nbuB
- active site: G18 (= G22), N111 (≠ S134), S139 (= S162), Q149 (≠ L172), Y152 (= Y176), K156 (= K180)
- binding acetoacetyl-coenzyme a: D93 (≠ E114), K98 (≠ E121), S139 (= S162), N146 (≠ A169), V147 (= V170), Q149 (≠ L172), Y152 (= Y176), F184 (≠ P208), M189 (≠ I213), K200 (= K226)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), N17 (≠ S21), G18 (= G22), I19 (≠ L23), D38 (= D42), F39 (≠ L43), V59 (≠ L55), D60 (= D68), V61 (= V69), N87 (= N95), A88 (= A96), G89 (= G97), I90 (= I98), T137 (= T160), S139 (= S162), Y152 (= Y176), K156 (= K180), P182 (= P206), F184 (≠ P208), T185 (≠ F209), T187 (= T211), M189 (≠ I213)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
31% identity, 95% coverage: 9:269/275 of query aligns to 5:259/261 of 6zzsD
- active site: G18 (= G22), S143 (= S162), Y156 (= Y176)
- binding nicotinamide-adenine-dinucleotide: G14 (= G18), S17 (= S21), I19 (≠ L23), D38 (= D42), M39 (≠ L43), D64 (= D68), V65 (= V69), N91 (= N95), A92 (= A96), G93 (= G97), M141 (≠ T160), A142 (≠ T161), S143 (= S162), Y156 (= Y176), K160 (= K180), P186 (= P206), G187 (= G207), V189 (≠ F209), T191 (= T211), L193 (≠ I213)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ E114), S143 (= S162), N145 (≠ S164), K153 (vs. gap), Y156 (= Y176), Q197 (≠ F217)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
33% identity, 94% coverage: 14:271/275 of query aligns to 8:244/251 of 6xewA
- active site: G16 (= G22), S138 (= S162), Y151 (vs. gap)
- binding r,3-hydroxybutan-2-one: S138 (= S162), S140 (= S164), Y151 (vs. gap)
- binding s,3-hydroxybutan-2-one: S138 (= S162), Y151 (vs. gap), S182 (≠ G207)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), N15 (≠ S21), G16 (= G22), M17 (≠ L23), D36 (= D42), W37 (≠ L43), W37 (≠ L43), A38 (≠ N44), I59 (≠ V66), D60 (= D68), V61 (= V69), N87 (= N95), A88 (= A96), G89 (= G97), V110 (= V133), T136 (= T160), S138 (= S162), Y151 (vs. gap), K155 (= K180), S182 (≠ G207), L183 (≠ P208), V184 (≠ F209), T186 (= T211), N187 (≠ D212), M188 (≠ I213), T189 (≠ G214)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
32% identity, 96% coverage: 7:270/275 of query aligns to 4:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G18), S17 (≠ A20), R18 (≠ S21), I20 (≠ L23), T40 (≠ M40), N62 (≠ D68), V63 (= V69), N89 (= N95), A90 (= A96), I92 (= I98), V139 (≠ T160), S141 (= S162), Y154 (= Y176), K158 (= K180), P184 (= P206), G185 (= G207), I187 (≠ F209), T189 (= T211), M191 (≠ I213)
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
33% identity, 94% coverage: 14:271/275 of query aligns to 8:244/251 of 6vspA
- active site: G16 (= G22), S138 (= S162), Y151 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), N15 (≠ S21), G16 (= G22), M17 (≠ L23), D36 (= D42), W37 (≠ L43), W37 (≠ L43), A38 (≠ N44), I59 (≠ V66), D60 (= D68), V61 (= V69), N87 (= N95), A88 (= A96), G89 (= G97), V90 (≠ I98), V110 (= V133), T136 (= T160), S138 (= S162), Y151 (vs. gap), K155 (= K180), P181 (= P206), S182 (≠ G207), L183 (≠ P208), V184 (≠ F209), T186 (= T211), N187 (≠ D212), M188 (≠ I213), T189 (≠ G214)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
32% identity, 96% coverage: 7:270/275 of query aligns to 4:242/243 of 4i08A
- active site: G19 (= G22), N113 (≠ S134), S141 (= S162), Q151 (vs. gap), Y154 (= Y176), K158 (= K180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G18), S17 (≠ A20), R18 (≠ S21), I20 (≠ L23), T40 (≠ M40), N62 (≠ D68), V63 (= V69), N89 (= N95), A90 (= A96), G140 (≠ T161), S141 (= S162), Y154 (= Y176), K158 (= K180), P184 (= P206), G185 (= G207), T189 (= T211)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
33% identity, 94% coverage: 14:271/275 of query aligns to 10:246/252 of 6vspB
Query Sequence
>PP_1951 FitnessBrowser__Putida:PP_1951
MKLDTVFSVEGARVIVTGAASGLGLAFTEAMAESGAQVAMLDLNREALDAQFRRLRSLGY
SVRSHVLDVTDRDAVDDTFNAVAAGFGGLDIVFANAGIDPGPGFAALNAAGEREPANMLE
EYSDHRWRKVISVSLDAVFYSIRAAARHMRANRSGSIIVTTSVSALRPAVTLGAAYAAAK
AGAAQLVRATALELASDGVRVNAIAPGPFETDIGGGFMHNSEVRAKMAAGVPMGRIAEVE
EIKPLALYLASKASSFVTGQQFVIDGGLSLSAARA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory