SitesBLAST
Comparing PP_1953 FitnessBrowser__Putida:PP_1953 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 99% coverage: 3:269/269 of query aligns to 5:244/244 of 4nbuB
- active site: G18 (= G16), N111 (= N136), S139 (= S164), Q149 (≠ P174), Y152 (= Y177), K156 (= K181)
- binding acetoacetyl-coenzyme a: D93 (= D108), K98 (≠ G113), S139 (= S164), N146 (≠ V171), V147 (≠ A172), Q149 (≠ P174), Y152 (= Y177), F184 (≠ S209), M189 (≠ L214), K200 (≠ F225)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (= I17), D38 (= D36), F39 (≠ L37), V59 (≠ T57), D60 (= D58), V61 (= V59), N87 (≠ A85), A88 (= A86), G89 (= G87), I90 (= I88), T137 (≠ I162), S139 (= S164), Y152 (= Y177), K156 (= K181), P182 (= P207), F184 (≠ S209), T185 (≠ V210), T187 (= T212), M189 (≠ L214)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
36% identity, 100% coverage: 2:269/269 of query aligns to 2:239/239 of 4nbtA
- active site: G16 (= G16), S132 (= S164), Y145 (= Y177), K149 (= K181)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), K15 (≠ S15), G16 (= G16), L17 (≠ I17), D36 (= D36), L37 (= L37), L52 (≠ T57), N53 (≠ D58), V54 (= V59), N80 (≠ A85), A81 (= A86), G82 (= G87), I130 (= I162), S132 (= S164), Y145 (= Y177), K149 (= K181), P177 (= P207), G178 (= G208), I180 (≠ V210), T182 (= T212)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
37% identity, 97% coverage: 6:267/269 of query aligns to 11:250/258 of 4wecA
- active site: G21 (= G16), S143 (= S164), Q154 (vs. gap), Y157 (= Y177), K161 (= K181)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), A19 (= A14), S20 (= S15), G21 (= G16), I22 (= I17), D41 (= D36), I42 (≠ L37), V61 (≠ T57), D62 (= D58), V63 (= V59), N89 (≠ A85), T141 (≠ I162), Y157 (= Y177), K161 (= K181), P187 (= P207), P189 (≠ S209), V190 (= V210)
5ts3A Crystal structure of a 3-oxoacyl-[acyl-carrier protein] reductase with bound NAD from brucella melitensis
38% identity, 100% coverage: 2:269/269 of query aligns to 16:264/265 of 5ts3A
- active site: G30 (= G16), S158 (= S164), V168 (≠ M173), Y172 (= Y177), K176 (= K181)
- binding nicotinamide-adenine-dinucleotide: G26 (= G12), R29 (≠ S15), G30 (= G16), I31 (= I17), D50 (= D36), L51 (= L37), D77 (= D58), V78 (= V59), N101 (≠ A85), V129 (= V135), T156 (≠ I162), Y172 (= Y177), K176 (= K181), P202 (= P207), I205 (≠ V210), T207 (= T212)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
37% identity, 99% coverage: 1:266/269 of query aligns to 1:242/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (= S15) binding
- D36 (= D36) binding
- D62 (= D58) binding
- I63 (≠ V59) binding
- N89 (≠ A85) binding
- Y153 (= Y177) binding
- K157 (= K181) binding
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
33% identity, 99% coverage: 3:269/269 of query aligns to 5:244/245 of 5t5qC
- active site: G18 (= G16), S140 (= S164), N150 (≠ P174), Y153 (= Y177), K157 (= K181)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ A14), G17 (≠ S15), G18 (= G16), I19 (= I17), D38 (= D36), L39 (= L37), D63 (= D58), A64 (≠ V59), S90 (≠ A85), I113 (≠ V135), Y153 (= Y177), K157 (= K181), P182 (= P207), I185 (≠ V210), T187 (= T212), M189 (≠ L214)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
32% identity, 98% coverage: 3:266/269 of query aligns to 3:244/248 of 6ixmC
- active site: G16 (= G16), S142 (= S164), Y155 (= Y177), K159 (= K181)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G16 (= G16), I17 (= I17), D36 (= D36), I37 (≠ L37), A61 (≠ T57), D62 (= D58), T63 (≠ V59), N89 (≠ A85), A90 (= A86), M140 (≠ I162), S142 (= S164), Y155 (= Y177), K159 (= K181), P185 (= P207), A186 (≠ G208), Y187 (≠ S209), I188 (≠ V210), L192 (= L214)
4is3C Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 in complex with a putative NAD(+)-oh- adduct at 2.0 a resolution
32% identity, 97% coverage: 4:265/269 of query aligns to 6:246/250 of 4is3C
- active site: G18 (= G16), E109 (≠ D128), S145 (= S164), Y158 (= Y177), K162 (= K181)
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), T16 (≠ A14), R17 (≠ S15), G18 (= G16), I19 (= I17), E39 (≠ L37), E43 (≠ L41), L67 (≠ V59), N93 (≠ A85), A94 (= A86), G95 (= G87), I116 (≠ V135), T143 (≠ I162), S145 (= S164), Y158 (= Y177), K162 (= K181), P188 (= P207), G189 (= G208), V190 (≠ S209), V191 (= V210), T193 (= T212), M195 (≠ L214)
P19337 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 2; 3alpha-hydroxysteroid dehydrogenase 2; 3alpha-HSDH 2; Bile acid-inducible protein BaiA2; EC 1.1.1.395 from Clostridium scindens (strain JCM 10418 / VPI 12708) (see paper)
32% identity, 97% coverage: 4:265/269 of query aligns to 5:245/249 of P19337
- TRGI 15:18 (≠ ASGI 14:17) binding
- E38 (≠ L37) binding
- E42 (≠ L41) binding ; mutation to A: Improves utilization of NADP(+) as cosubstrate by 10-fold compared to wild-type. Displays 6-fold increase in affinity for NADP(+).
- N92 (≠ A85) binding
- K161 (= K181) binding
- VNT 190:192 (≠ VDT 210:212) binding
7krmC Putative fabg bound to nadh from acinetobacter baumannii
35% identity, 99% coverage: 1:267/269 of query aligns to 1:241/244 of 7krmC
- active site: G18 (= G16), S140 (= S164), Y155 (= Y177)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G18 (= G16), I19 (= I17), D38 (= D36), L39 (= L37), A60 (≠ T57), N61 (≠ D58), V62 (= V59), N88 (≠ A85), V111 (= V135), S140 (= S164), Y155 (= Y177), K159 (= K181), I188 (≠ V210), T190 (= T212)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
35% identity, 98% coverage: 5:267/269 of query aligns to 1:249/253 of 4nbwA
- active site: G12 (= G16), S146 (= S164), Y159 (= Y177), K163 (= K181)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), N11 (≠ S15), G12 (= G16), I13 (= I17), D32 (= D36), L33 (= L37), V57 (= V72), D58 (= D73), V59 (vs. gap), N85 (≠ A85), A86 (= A86), G87 (= G87), S146 (= S164), Y159 (= Y177), K163 (= K181), I192 (≠ V210), T194 (= T212)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 99% coverage: 1:267/269 of query aligns to 2:249/252 of 1vl8B
- active site: G17 (= G16), S143 (= S164), I154 (≠ Y176), Y157 (= Y177), K161 (= K181)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), R16 (≠ S15), G17 (= G16), L18 (≠ I17), S37 (≠ A34), R38 (≠ M35), C63 (≠ T57), D64 (= D58), V65 (= V59), A91 (= A85), A92 (= A86), G93 (= G87), I94 (= I88), V114 (= V135), I141 (= I162), S143 (= S164), Y157 (= Y177), K161 (= K181), P187 (= P207), G188 (= G208), Y190 (≠ V210), T192 (= T212), M194 (≠ L214), T195 (≠ M215)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
33% identity, 99% coverage: 1:267/269 of query aligns to 4:245/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G12), R18 (≠ S15), G19 (= G16), I20 (= I17), D39 (= D36), R40 (≠ L37), C63 (≠ T57), I65 (≠ V59), N91 (≠ A85), G93 (= G87), I94 (= I88), V114 (= V135), Y155 (= Y177), K159 (= K181), I188 (≠ V210), T190 (= T212), T193 (≠ M215)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
32% identity, 100% coverage: 1:269/269 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G16), S142 (= S164), Q152 (≠ P174), Y155 (= Y177), K159 (= K181)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ A14), R15 (≠ S15), G16 (= G16), I17 (= I17), N35 (vs. gap), Y36 (vs. gap), N37 (vs. gap), G38 (vs. gap), S39 (vs. gap), N63 (≠ D58), V64 (= V59), N90 (≠ A85), A91 (= A86), I93 (= I88), I113 (≠ V135), S142 (= S164), Y155 (= Y177), K159 (= K181), P185 (= P207), I188 (≠ V210), T190 (= T212)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
30% identity, 99% coverage: 3:269/269 of query aligns to 5:247/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
30% identity, 99% coverage: 3:269/269 of query aligns to 5:247/255 of 2dteA
- active site: G18 (= G16), S132 (= S164), Y145 (= Y177), S148 (= S180), K149 (= K181)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S16 (≠ A14), M17 (≠ S15), G18 (= G16), I19 (= I17), S38 (≠ D36), I39 (≠ L37), C52 (= C54), D53 (= D58), V54 (= V59), N80 (≠ A85), A81 (= A86), I130 (= I162), S132 (= S164), Y145 (= Y177), K149 (= K181), P174 (= P207), A175 (≠ G208), T176 (≠ S209), I177 (≠ V210), T179 (= T212), P180 (= P213), L181 (= L214), V182 (≠ M215)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
33% identity, 99% coverage: 2:267/269 of query aligns to 4:251/254 of 4fn4A
- active site: G18 (= G16), S144 (= S164), Y157 (= Y177), K161 (= K181), S202 (≠ P220)
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (= I17), E38 (≠ D36), L39 (= L37), R43 (vs. gap), A63 (≠ T57), D64 (= D58), V65 (= V59), N91 (≠ A85), G93 (= G87), I94 (= I88), T142 (≠ I162), S144 (= S164), Y157 (= Y177), K161 (= K181), P187 (= P207), V190 (= V210), T192 (= T212), N193 (≠ P213), I194 (vs. gap)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
31% identity, 100% coverage: 1:269/269 of query aligns to 1:243/244 of 6t77A
- active site: G16 (= G16), S138 (= S164), Y151 (= Y177)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ A14), R15 (≠ S15), T37 (vs. gap), L58 (≠ I55), N59 (≠ D58), V60 (= V59), A87 (= A86), G88 (= G87), I89 (= I88)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
32% identity, 99% coverage: 1:266/269 of query aligns to 5:247/251 of 6d9yB
- active site: G20 (= G16), S145 (= S164), Y158 (= Y177)
- binding nicotinamide-adenine-dinucleotide: G16 (= G12), R19 (≠ S15), G20 (= G16), D40 (= D36), L41 (= L37), V64 (≠ T57), D65 (= D58), Q66 (≠ V59), A93 (= A86), S145 (= S164), Y158 (= Y177), K162 (= K181), P188 (= P207), A189 (≠ G208), A190 (≠ S209), A191 (≠ V210), T193 (= T212)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
31% identity, 98% coverage: 3:266/269 of query aligns to 11:262/267 of Q9LBG2
- 17:42 (vs. 9:34, 42% identical) binding
- E103 (= E94) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
Query Sequence
>PP_1953 FitnessBrowser__Putida:PP_1953
MSFQNKIVVLTGAASGIGKATAQLLVEQGAHVVAMDLKSDLLQQAFGSEEHVLCIPTDVS
DSEAVRAAFQAVDAKFGRVDVIINAAGINAPTREANQKMVDANVAALDAMKSGRAPTFDF
LADTSDQDFRRVMEVNLFSQFYCIREGVPLMRRAGGGSIVNISSVAALLGVAMPLYYPAS
KAAVLGLTRAAAAELAPYNIRVNAIAPGSVDTPLMHEQPPEVVQFLVSMQPIKRLAQPEE
LAQSILFLAGEHSSFITGQTLSPNGGMHM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory