SitesBLAST
Comparing PP_1992 PP_1992 aspartate-semialdehyde dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
40% identity, 99% coverage: 1:331/334 of query aligns to 1:334/337 of P23247
- C132 (≠ S129) active site, Acyl-thioester intermediate
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
40% identity, 98% coverage: 5:331/334 of query aligns to 4:333/336 of 2r00C
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
35% identity, 99% coverage: 1:331/334 of query aligns to 1:342/346 of Q04797
- S98 (≠ G98) modified: Phosphoserine
- Y146 (≠ L145) modified: Phosphotyrosine
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G75), S73 (≠ A76), T94 (≠ S97), S95 (≠ G98), R98 (vs. gap), K222 (≠ R213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), S70 (≠ A73), A71 (≠ T74), G72 (= G75), T75 (≠ V78), N93 (≠ L96), T94 (≠ S97), N126 (≠ C128), C127 (≠ S129), G160 (= G162), G328 (= G317)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (≠ A73), G72 (= G75), S73 (≠ A76), N93 (≠ L96), T94 (≠ S97), S95 (≠ G98), R98 (vs. gap), K222 (≠ R213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), A71 (≠ T74), G160 (= G162), M161 (≠ R163), G162 (≠ E164)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/357 of 4r3nA
- active site: C127 (≠ S129), Q154 (≠ L156), R244 (≠ Q235), H251 (≠ D242)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ A76), T94 (≠ S97), S95 (≠ G98), R98 (vs. gap), N126 (≠ C128), K222 (≠ R213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), V13 (= V16), A35 (= A38), S36 (= S39), S39 (= S42), T56 (≠ V59), S70 (≠ A73), A71 (≠ T74), G72 (= G75), N93 (≠ L96), T94 (≠ S97), N126 (≠ C128), C127 (≠ S129), G160 (= G162), M161 (≠ R163), G328 (= G317)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/357 of 3q1lA
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/361 of 3pylC
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (vs. gap), N126 (≠ C128), G158 (≠ A160), I208 (≠ V199), E219 (≠ L210), K222 (≠ R213), R244 (≠ Q235)
- binding adenosine-2'-5'-diphosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), A71 (≠ T74), T75 (≠ V78), G160 (= G162), M161 (≠ R163)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), A71 (≠ T74), T75 (≠ V78), G160 (= G162)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (vs. gap), N126 (≠ C128), G158 (≠ A160), A159 (≠ Q161), E219 (≠ L210), K222 (≠ R213), R244 (≠ Q235)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/357 of 2gz3A
- active site: C127 (≠ S129), Q154 (≠ L156), R244 (≠ Q235), H251 (≠ D242)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (≠ S129), Q154 (≠ L156), G158 (≠ A160), E219 (≠ L210), R244 (≠ Q235), H251 (≠ D242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), S70 (≠ A73), A71 (≠ T74), G72 (= G75), T75 (≠ V78), N93 (≠ L96), G158 (≠ A160), G160 (= G162), M161 (≠ R163), N324 (= N313), A329 (= A318)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/357 of 2gz2A
- active site: C127 (≠ S129), Q154 (≠ L156), R244 (≠ Q235), H251 (≠ D242)
- binding adenosine-2'-5'-diphosphate: G8 (= G11), T10 (= T13), G11 (= G14), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), A71 (≠ T74), T75 (≠ V78)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/357 of 2gz1A
- active site: C127 (≠ S129), Q154 (≠ L156), R244 (≠ Q235), H251 (≠ D242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), S70 (≠ A73), A71 (≠ T74), G72 (= G75), T75 (≠ V78), N93 (≠ L96), S157 (= S159), G158 (≠ A160), G160 (= G162), M161 (≠ R163), N324 (= N313), L325 (≠ V314)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), V13 (= V16), A35 (= A38), S36 (= S39), S39 (= S42), T56 (≠ V59), S70 (≠ A73), A71 (≠ T74), G72 (= G75), N93 (≠ L96), T94 (≠ S97), N126 (≠ C128), C127 (≠ S129), G160 (= G162), M161 (≠ R163), G328 (= G317)
- binding phthalic acid: S73 (≠ A76), T94 (≠ S97), S95 (≠ G98), R98 (vs. gap), N126 (≠ C128), K222 (≠ R213)
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ A76), T94 (≠ S97), S95 (≠ G98), R98 (vs. gap), N126 (≠ C128), C127 (≠ S129), Q154 (≠ L156), G158 (≠ A160), K222 (≠ R213), R244 (≠ Q235), H251 (≠ D242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), S70 (≠ A73), A71 (≠ T74), G72 (= G75), T75 (≠ V78), N93 (≠ L96), T94 (≠ S97), P125 (= P127), N126 (≠ C128), C127 (≠ S129), G160 (= G162), M161 (≠ R163), G328 (= G317)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ S97), S95 (≠ G98), R98 (vs. gap), N126 (≠ C128), C127 (≠ S129), Q154 (≠ L156), G158 (≠ A160), E219 (≠ L210), K222 (≠ R213), R244 (≠ Q235), H251 (≠ D242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), S70 (≠ A73), A71 (≠ T74), G72 (= G75), T75 (≠ V78), N93 (≠ L96), T94 (≠ S97), N126 (≠ C128), C127 (≠ S129), G160 (= G162), M161 (≠ R163), G328 (= G317)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (vs. gap), G158 (≠ A160), E219 (≠ L210), K222 (≠ R213), R244 (≠ Q235)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A12 (≠ S15), V13 (= V16), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), S70 (≠ A73), A71 (≠ T74), G72 (= G75), T75 (≠ V78), C127 (≠ S129), S157 (= S159), G158 (≠ A160), G160 (= G162), M161 (≠ R163), N324 (= N313), L325 (≠ V314)
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
31% identity, 97% coverage: 7:329/334 of query aligns to 4:340/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), T10 (= T13), G11 (= G14), A35 (= A38), S36 (= S39), R38 (≠ E41), S39 (= S42), T56 (≠ V59), A71 (≠ T74), T75 (≠ V78), G160 (= G162), M161 (≠ R163), G162 (≠ E164)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (vs. gap), N126 (≠ C128), C127 (≠ S129), Q154 (≠ L156), G158 (≠ A160), E219 (≠ L210), K222 (≠ R213), R244 (≠ Q235)
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
35% identity, 97% coverage: 5:329/334 of query aligns to 2:340/342 of 3tz6A
- active site: C129 (= C128), Q156 (≠ L156), R248 (≠ Q235), H255 (≠ D242)
- binding cysteine: C129 (= C128), Q156 (≠ L156), G160 (≠ A160), E223 (≠ L210), R248 (≠ Q235), H255 (≠ D242)
- binding glycerol: S108 (≠ P108), G187 (≠ A179), F192 (vs. gap), P201 (≠ Q190), Q225 (≠ R212), R228 (≠ V215), F229 (≠ S216), Q335 (= Q324), E338 (≠ Q327), L339 (= L328)
- binding sulfate ion: R98 (vs. gap), H117 (≠ S117), R119 (≠ S119), N128 (vs. gap), C129 (= C128), K226 (≠ R213), E270 (≠ A257), R273 (≠ N260)
Q57658 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
22% identity, 98% coverage: 5:331/334 of query aligns to 9:351/354 of Q57658
Query Sequence
>PP_1992 PP_1992 aspartate-semialdehyde dehydrogenase
MTHPLDIAVVGATGSVGEALVQILEELAFPVATLHLLASMESAGSSVMFAGKKLKVREVD
SFDFAQVKLAFFATGAAVSRSFAGKALQAGCTVIDLSGGLDDALALVPEANAERLASLSL
PARIVSPCSAAVALAVALAPLKGLLDIERVQVMAALAVSAQGREAVSELARQTAELLNAR
PLEPRFFDRQVAFNLLAQVGAADEQGHTALERRLVSELRVLLGLPELKISVSCVQVPVFF
GDSFSVAVQSRRPVDLAAVNQALEAADSIERVENDDYPTPVGDAVGQDVVYVGRVRHGVD
EDQQLNLWLTTDNVRKGAALNAVQVAQLLIKHMP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory