Comparing PP_2036 FitnessBrowser__Putida:PP_2036 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
71% identity, 98% coverage: 6:293/295 of query aligns to 3:290/291 of 3na8A
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
34% identity, 92% coverage: 5:275/295 of query aligns to 1:270/292 of Q07607
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
30% identity, 97% coverage: 6:290/295 of query aligns to 2:285/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
30% identity, 97% coverage: 6:290/295 of query aligns to 2:285/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
30% identity, 97% coverage: 6:290/295 of query aligns to 2:285/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
30% identity, 97% coverage: 6:290/295 of query aligns to 2:285/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
30% identity, 97% coverage: 6:290/295 of query aligns to 2:285/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
30% identity, 97% coverage: 6:290/295 of query aligns to 2:285/291 of 3pueB
4pfmA Shewanella benthica dhdps with lysine and pyruvate
32% identity, 94% coverage: 5:281/295 of query aligns to 2:278/295 of 4pfmA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 97% coverage: 5:290/295 of query aligns to 1:288/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
28% identity, 97% coverage: 5:290/295 of query aligns to 2:289/295 of 1o5kA
5ud6C Crystal structure of dhdps from cyanidioschyzon merolae with lysine bound
29% identity, 96% coverage: 9:292/295 of query aligns to 7:294/299 of 5ud6C
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
29% identity, 92% coverage: 8:279/295 of query aligns to 5:281/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
29% identity, 92% coverage: 8:279/295 of query aligns to 5:281/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 92% coverage: 8:279/295 of query aligns to 5:281/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 92% coverage: 8:279/295 of query aligns to 5:281/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
29% identity, 92% coverage: 8:279/295 of query aligns to 5:281/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
29% identity, 92% coverage: 8:279/295 of query aligns to 5:281/298 of 3nevA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
31% identity, 88% coverage: 14:274/295 of query aligns to 17:274/297 of 5j5dA
Sites not aligning to the query:
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
31% identity, 88% coverage: 14:274/295 of query aligns to 16:273/296 of 1xxxA
>PP_2036 FitnessBrowser__Putida:PP_2036
MSTPVIRGVIGYTITPFTADGTLDLDALGTSIDSLIAGGVHAIAPLGSTGEGAYLSDSEW
ETVVRFSQARIAGRVPSVVSVSDLTTARTVQRARLAQACGATAVMVLPISYWKLTEAEVV
AHYKAVGAAIDIPIMLYNNPGTSGTDLSVELILRILGEVPNVTMVKESTGDIQRMHRLFT
ATDGQVAFYNGCNPLTLEALVAGATGWCTAAPNLIPALNLALWDAVQQGDLAEARALFYR
QYELLEYITRRGLPTTIKAGLKMLGQDVGAPRLPLQPLDAQGSNHLKSLLVALTN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory