Comparing PP_2077 FitnessBrowser__Putida:PP_2077 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
60% identity, 94% coverage: 14:400/410 of query aligns to 22:410/419 of 1ko0A
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
60% identity, 94% coverage: 14:400/410 of query aligns to 23:411/420 of P00861
1knwA Crystal structure of diaminopimelate decarboxylase
60% identity, 94% coverage: 16:400/410 of query aligns to 24:410/421 of 1knwA
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
33% identity, 98% coverage: 10:409/410 of query aligns to 6:400/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
32% identity, 98% coverage: 10:409/410 of query aligns to 4:392/394 of 3c5qA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
32% identity, 97% coverage: 7:405/410 of query aligns to 3:382/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
32% identity, 97% coverage: 7:405/410 of query aligns to 2:381/385 of 2yxxA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
32% identity, 96% coverage: 10:403/410 of query aligns to 20:409/418 of 4xg1B
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
32% identity, 89% coverage: 40:405/410 of query aligns to 64:425/434 of 1tufA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
32% identity, 89% coverage: 40:405/410 of query aligns to 68:429/438 of Q58497
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
32% identity, 89% coverage: 40:405/410 of query aligns to 64:425/434 of 1twiA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
31% identity, 96% coverage: 10:403/410 of query aligns to 18:384/393 of 4xg1A
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
32% identity, 94% coverage: 18:404/410 of query aligns to 31:416/422 of 6n2aA
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
26% identity, 97% coverage: 12:407/410 of query aligns to 12:410/412 of 7ru7A
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
28% identity, 99% coverage: 4:407/410 of query aligns to 30:445/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
28% identity, 99% coverage: 4:407/410 of query aligns to 29:444/446 of 1hkvA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
28% identity, 99% coverage: 4:408/410 of query aligns to 31:443/443 of 5x7mA
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
28% identity, 99% coverage: 4:407/410 of query aligns to 31:442/442 of 5x7nA
5gjpA Crystal structure of srldc in complex with plp and cadaverine (see paper)
26% identity, 85% coverage: 40:388/410 of query aligns to 46:365/381 of 5gjpA
Q9FPK5 Ornithine decarboxylase, chloroplastic; Lysine decarboxylase; EC 4.1.1.17; EC 4.1.1.18 from Nicotiana glutinosa (Tobacco) (see paper)
25% identity, 91% coverage: 5:376/410 of query aligns to 52:415/432 of Q9FPK5
>PP_2077 FitnessBrowser__Putida:PP_2077
MTAPFTLLAEAVRQHGSPLWAYDTRTIADRVEQLNVFDTVRFAQKANPNLHVLRLMRAHG
LVLDAVSLGEMERAFAAGASVDGDPAGVVLTCDALDRPTLERVVASKIEVNAGSIDMLHQ
LGERSPGHRVWIRINPGFGHGHSRKTNTGGENSKHGIWHEELDEALACIKAHGLHLVGVH
MHIGSGVDYQHLEQVARSMIELIGRLGVDIEAFSIGGGLSTPYRSTDKPVDLQRYAQTWA
VARKEIEAMLGHPVRMEIEPGRFLVAESGYLVAEVRAVKQVGRNTFVIIDAGFNDLMRPA
MYGAYHGMTLLDADGQAVDRPRQPTVVAGPLCESGDVFTQDDQALTPQDLPQAQVGDLLV
IHDAGAYGASMSSNYNSRPLLPEFLIENGALRMIRRRQTVQDLLSLEADF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory